BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0444.Seq (497 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 3.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.2 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 6.2 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 3.5 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +3 Query: 240 VCEXLRSVPRQTISVCACAQDQAPE 314 +C+ +S +QT+ +C ++ PE Sbjct: 294 ICDSAKSESQQTVFLCYKLMEKFPE 318 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 6.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 323 NLRNPLDPHRIPGGRLDLRVKFWVPPHLLINE 418 NLRN H+ +L+ +FWV I E Sbjct: 1259 NLRNQNLSHQAKNLDSNLKYEFWVTAATTIGE 1290 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 420 GSLMSR*GGTQNLTRRSSRPP 358 GSL+S G T N + S PP Sbjct: 55 GSLLSPSGNTPNKSSTSPYPP 75 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,951 Number of Sequences: 336 Number of extensions: 2297 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -