BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0444.Seq (497 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC146.03c |cut3|smc4, smc4|condensin subunit Cut3|Schizosaccha... 27 1.6 SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces pom... 26 3.6 SPCC23B6.01c |||oxysterol binding protein |Schizosaccharomyces p... 25 4.8 SPAC22E12.17c |glo3||ARF GTPase activating protein|Schizosacchar... 25 8.4 SPBC32F12.12c |||conserved fungal protein|Schizosaccharomyces po... 25 8.4 >SPBC146.03c |cut3|smc4, smc4|condensin subunit Cut3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1324 Score = 27.1 bits (57), Expect = 1.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 128 VKFNKSGRKIFSLMNLTHVTIVYLTRAKYLFKKVLLNSL 12 + F K ++F N + TI+Y TR K + LLNSL Sbjct: 344 LSFLKDENELFMKQNQLYRTILYETRNKKTLVQNLLNSL 382 >SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 963 Score = 25.8 bits (54), Expect = 3.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 390 QNLTRRSSRPPGMRCGSRGFRKLSHXPGPDP 298 +N TR+S +P + SRG RK DP Sbjct: 153 RNATRKSKKPSASKDTSRGVRKSKAGAPSDP 183 >SPCC23B6.01c |||oxysterol binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 489 Score = 25.4 bits (53), Expect = 4.8 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 418 FVDEQVRGHPELDAEV*PSSGYAVRIEGVPQVKPXS 311 + EQV HP + A Y VRI+GV VKP S Sbjct: 141 YAAEQVCHHPPISAYFYLCPEYKVRIDGV--VKPRS 174 >SPAC22E12.17c |glo3||ARF GTPase activating protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 486 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 301 SWAHAQTEIVCLGTDLNXSHTFSRH 227 SW +AQ ++ +G + N + F RH Sbjct: 71 SWTYAQLRVMRVGGNENARNYFKRH 95 >SPBC32F12.12c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 164 Score = 24.6 bits (51), Expect = 8.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 101 IFSLMNLTHVTIVYLTRAKYLFKKVLL 21 I ++NL HVT+V L A + + VLL Sbjct: 40 ILGIVNLFHVTLVVLFSALTIIEGVLL 66 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,966,918 Number of Sequences: 5004 Number of extensions: 38481 Number of successful extensions: 87 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -