BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0443.Seq (693 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|... 26 5.9 SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosacch... 26 5.9 SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe... 25 7.9 SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MB... 25 7.9 >SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 675 YPLVPQEKGSPNSLKWLSKPLPN 607 Y VPQ+ SPN + +PLPN Sbjct: 123 YVAVPQKSTSPNQVCSYCEPLPN 145 >SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 320 DIGQVLKAARLLCKPPQQVDFEDEQEMRF 406 ++G+V ++ L+C PQ DF D Q + F Sbjct: 349 EVGEVEQS--LVCNEPQSTDFNDIQRLLF 375 >SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe|chr 1|||Manual Length = 727 Score = 25.4 bits (53), Expect = 7.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 257 VPAKNPHAPPPVSVKTTGPVWD 322 +P +P P + +T GP+WD Sbjct: 671 IPRAHPQLPKNLLSQTAGPLWD 692 >SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 1|||Manual Length = 588 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 381 SRTNKKCVSFILLFMTFSDINVSWT--RPWTIL 473 S +SFI+LFMT+ + + W R W+++ Sbjct: 373 SAVESAMISFIVLFMTWLKLLIPWRLFRLWSLI 405 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,858,909 Number of Sequences: 5004 Number of extensions: 59582 Number of successful extensions: 168 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -