BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0442.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0616 + 26145395-26146312 28 3.6 02_01_0626 - 4694150-4694356,4694443-4694556,4694581-4694991,469... 28 3.6 >03_05_0616 + 26145395-26146312 Length = 305 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 214 LHSVTYNRNPRVIFVRYRPKVLGFIYRINFF*L*SKTPNI 333 L + ++ I +RY K +GF+ + NF L + PNI Sbjct: 62 LRELILSQKTNSILIRYLEKEVGFVQKWNFLSLIKRHPNI 101 >02_01_0626 - 4694150-4694356,4694443-4694556,4694581-4694991, 4695252-4695582,4695667-4695753,4695839-4696218, 4696360-4696934,4699036-4699207,4699832-4699846 Length = 763 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 37 FSYTKKENCDLFNTEIIIIFRLHL-SIRACIIKTSQCHKYIVKSC*R*WASSILHTLAEI 213 F +T+ + LF + ++ L L S+ K+ CH K+C A++I T+A + Sbjct: 67 FLFTEYKYVGLFMSIFAVLIFLFLGSVEGFSTKSQPCHYSKDKTCKPALANAIFSTIAFV 126 Query: 214 LHSVT 228 L +VT Sbjct: 127 LGAVT 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,818,773 Number of Sequences: 37544 Number of extensions: 155779 Number of successful extensions: 199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 196 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -