BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0440.Seq (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 22 4.5 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 22 4.5 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 6.0 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 22.2 bits (45), Expect = 4.5 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +2 Query: 293 ADLNFDNPKVVEKFDMVLKAWMGAGASGVRLNNARHLLVELLEEKTRVGRGSSVDADH 466 ADLN + V K + + G +G R++ A+H+ LE G +++ DH Sbjct: 173 ADLNQGSDYVRSKIIEYMNHLVDLGVAGFRVDAAKHMWPADLE--AIYGSLKNLNTDH 228 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.2 bits (45), Expect = 4.5 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +2 Query: 293 ADLNFDNPKVVEKFDMVLKAWMGAGASGVRLNNARHLLVELLEEKTRVGRGSSVDADH 466 ADLN + V K + + G +G R++ A+H+ LE G +++ DH Sbjct: 173 ADLNQGSDYVRSKIIEYMNHLVDLGVAGFRVDAAKHMWPADLE--AIYGSLKNLNTDH 228 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 293 ADLNFDNPKVVEKFDMVLKAWMGAGASGVRLNNARHL 403 ADLN + V K + + G +G R++ A+H+ Sbjct: 172 ADLNQGSDYVRSKIIEYMNHLVDLGVAGFRVDAAKHM 208 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,874 Number of Sequences: 336 Number of extensions: 2589 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -