BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0437.Seq (827 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_30515| Best HMM Match : Lyase_8 (HMM E-Value=1.2e-05) 29 4.6 SB_16164| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_13786| Best HMM Match : Borrelia_orfD (HMM E-Value=3.3) 28 8.0 >SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 30.3 bits (65), Expect = 2.0 Identities = 26/61 (42%), Positives = 33/61 (54%) Frame = +2 Query: 263 QPEAAQAPSTGQVYIPDRRRQTLADTSYVPQQENEVYYPQQPENPIFSPTQAIELADPTE 442 Q E A A S V +P+R QT + S P+Q N+V PQ E P S T A LA+P E Sbjct: 625 QHELAVADSP-VVCLPER--QTHSGESATPEQTNQVVEPQM-EEPQGS-TSAQHLAEPDE 679 Query: 443 K 445 + Sbjct: 680 Q 680 >SB_30515| Best HMM Match : Lyase_8 (HMM E-Value=1.2e-05) Length = 1364 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 213 YYNPRAVGGGMAAFCTASPKP 275 YYNP+ +GGGMA TA P Sbjct: 926 YYNPKDLGGGMAMRGTAGKTP 946 >SB_16164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/57 (24%), Positives = 22/57 (38%) Frame = -3 Query: 339 VSARVWRRRSGMYTWPVEGACAASGWRYRTRPYHRLQLWGCSKDCSNGS*PSLLGYY 169 +S R W R+ +W + Y YH+ + GC C + + GYY Sbjct: 133 LSVRAWGRKREYQSWSAWKIYRVP-YEYAFPDYHQFKYGGCQVGCGPVAWAQVFGYY 188 >SB_13786| Best HMM Match : Borrelia_orfD (HMM E-Value=3.3) Length = 258 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = +2 Query: 626 HHPECPHPRSSNVLRMGGRRSGPEPTAVARYSTVEEASHSTHATVDRRVKNCN 784 +H E PR + + GR S P T + Y+T + +ST R N Sbjct: 10 NHREDDLPRKGHACGVMGRPSAPSTTKASSYATAVQNGNSTGRETHRESNQTN 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,460,371 Number of Sequences: 59808 Number of extensions: 522871 Number of successful extensions: 1546 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1545 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -