BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0436.Seq (796 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U47292-1|AAB05397.1| 129|Homo sapiens spasmolytic peptide protein. 35 0.29 BC032820-1|AAH32820.1| 129|Homo sapiens trefoil factor 2 (spasm... 35 0.29 AB038162-2|BAB13730.1| 129|Homo sapiens trefoil factor 2 protein. 35 0.29 X51698-1|CAA35995.1| 130|Homo sapiens spasmolytic polypeptide p... 35 0.39 AB051390-1|BAB18461.1| 807|Homo sapiens VSGP/F-spondin protein. 30 8.4 >U47292-1|AAB05397.1| 129|Homo sapiens spasmolytic peptide protein. Length = 129 Score = 35.1 bits (77), Expect = 0.29 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 15/91 (16%) Frame = -3 Query: 446 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 303 SP N + C FP FD CF S V C + +P + +C R NC Sbjct: 35 SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 91 Query: 302 LSP*FAPDQCSSSKISFQG-VFDIP--HFPR 219 P +P++C+S K F +F++P FP+ Sbjct: 92 GYPGISPEECASRKCCFSNFIFEVPWCFFPK 122 >BC032820-1|AAH32820.1| 129|Homo sapiens trefoil factor 2 (spasmolytic protein 1) protein. Length = 129 Score = 35.1 bits (77), Expect = 0.29 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 15/91 (16%) Frame = -3 Query: 446 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 303 SP N + C FP FD CF S V C + +P + +C R NC Sbjct: 35 SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 91 Query: 302 LSP*FAPDQCSSSKISFQG-VFDIP--HFPR 219 P +P++C+S K F +F++P FP+ Sbjct: 92 GYPGISPEECASRKCCFSNFIFEVPWCFFPK 122 >AB038162-2|BAB13730.1| 129|Homo sapiens trefoil factor 2 protein. Length = 129 Score = 35.1 bits (77), Expect = 0.29 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 15/91 (16%) Frame = -3 Query: 446 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 303 SP N + C FP FD CF S V C + +P + +C R NC Sbjct: 35 SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 91 Query: 302 LSP*FAPDQCSSSKISFQG-VFDIP--HFPR 219 P +P++C+S K F +F++P FP+ Sbjct: 92 GYPGISPEECASRKCCFSNFIFEVPWCFFPK 122 >X51698-1|CAA35995.1| 130|Homo sapiens spasmolytic polypeptide protein. Length = 130 Score = 34.7 bits (76), Expect = 0.39 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 13/85 (15%) Frame = -3 Query: 446 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 303 SP N + C FP FD CF S V C + +P + +C R NC Sbjct: 36 SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 92 Query: 302 LSP*FAPDQCSSSKISFQG-VFDIP 231 P +P++C+S K F +F++P Sbjct: 93 GYPGISPEECASRKCCFSNFIFEVP 117 >AB051390-1|BAB18461.1| 807|Homo sapiens VSGP/F-spondin protein. Length = 807 Score = 30.3 bits (65), Expect = 8.4 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -3 Query: 443 PENGSVCSFPLFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRCRNNC 303 PE+GSVC+ P ++ C ++ S C++ + +W C C Sbjct: 532 PEDGSVCTLPTEEMEKCTVNEECSPSSCLMTEWG----EWDECSATC 574 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,185,926 Number of Sequences: 237096 Number of extensions: 1599977 Number of successful extensions: 4173 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4167 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9757565650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -