BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0435.Seq (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 9.2 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 9.2 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 9.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 137 DTLSHIRH*TADSXFPSNTSDMMLRYFTLLPSPDEPLFARA 15 + +SHI + T F + +FT LP D+ L RA Sbjct: 229 NAVSHICNATNKQLFQLVAWAKHIPHFTSLPLEDQVLLLRA 269 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 9.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 137 DTLSHIRH*TADSXFPSNTSDMMLRYFTLLPSPDEPLFARA 15 + +SHI + T F + +FT LP D+ L RA Sbjct: 229 NAVSHICNATNKQLFQLVAWAKHIPHFTSLPLEDQVLLLRA 269 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,088 Number of Sequences: 438 Number of extensions: 2159 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -