BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0435.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22030.2 68418.m02564 ubiquitin-specific protease 8, putative... 54 5e-08 At5g22030.1 68418.m02563 ubiquitin-specific protease 8, putative... 54 5e-08 At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase f... 52 4e-07 At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) ... 50 9e-07 At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase f... 50 1e-06 At4g10590.2 68417.m01733 ubiquitin carboxyl-terminal hydrolase f... 49 3e-06 At4g10590.1 68417.m01732 ubiquitin carboxyl-terminal hydrolase f... 49 3e-06 At4g10570.1 68417.m01730 ubiquitin carboxyl-terminal hydrolase f... 49 3e-06 At2g32780.1 68415.m04013 ubiquitin-specific protease 1, putative... 48 6e-06 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 47 8e-06 At2g40930.1 68415.m05052 ubiquitin-specific protease 5, putative... 47 8e-06 At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase f... 47 1e-05 At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22) ... 46 2e-05 At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25) ... 45 3e-05 At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putativ... 42 2e-04 At4g39910.1 68417.m05653 ubiquitin-specific protease 3 (UBP3) id... 42 3e-04 At2g22310.1 68415.m02647 ubiquitin-specific protease 4 (UBP4) id... 42 3e-04 At5g57990.1 68418.m07255 ubiquitin-specific protease 23, putativ... 41 7e-04 At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2) id... 39 0.002 At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ... 36 0.027 At4g17895.1 68417.m02667 ubiquitin-specific protease 20, putativ... 33 0.11 At5g06600.2 68418.m00746 ubiquitin-specific protease 12 (UBP12) ... 31 0.58 At5g06600.1 68418.m00745 ubiquitin-specific protease 12 (UBP12) ... 31 0.58 At3g11910.1 68416.m01460 ubiquitin-specific protease, putative s... 31 0.58 At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21) ... 29 3.1 At5g07120.1 68418.m00812 phox (PX) domain-containing protein sim... 27 7.2 At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (... 27 7.2 At5g10120.1 68418.m01172 ethylene insensitive 3 family protein c... 27 9.5 At1g02080.1 68414.m00130 transcriptional regulator-related conta... 27 9.5 >At5g22030.2 68418.m02564 ubiquitin-specific protease 8, putative (UBP8) similar to ubiquitin-specific protease 8 partial sequence GI:11993469 [Arabidopsis thaliana] Length = 622 Score = 54.4 bits (125), Expect = 5e-08 Identities = 27/70 (38%), Positives = 38/70 (54%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 VSL CL AF + + L D+M+ C CK+ R +K + LP +L +HLKRF + Sbjct: 473 VSLFKCLEAFLTEEPLGPDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMK 532 Query: 489 XKVAARVPSP 518 K+ A V P Sbjct: 533 NKLEAYVDFP 542 Score = 37.1 bits (82), Expect = 0.009 Identities = 18/38 (47%), Positives = 22/38 (57%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIP 180 SII DV G S + C IC +VS + F LSLP+P Sbjct: 172 SIIVDVCQGQYKSTLVCPICKKVSVMFDPFMYLSLPLP 209 >At5g22030.1 68418.m02563 ubiquitin-specific protease 8, putative (UBP8) similar to ubiquitin-specific protease 8 partial sequence GI:11993469 [Arabidopsis thaliana] Length = 622 Score = 54.4 bits (125), Expect = 5e-08 Identities = 27/70 (38%), Positives = 38/70 (54%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 VSL CL AF + + L D+M+ C CK+ R +K + LP +L +HLKRF + Sbjct: 473 VSLFKCLEAFLTEEPLGPDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMK 532 Query: 489 XKVAARVPSP 518 K+ A V P Sbjct: 533 NKLEAYVDFP 542 Score = 37.1 bits (82), Expect = 0.009 Identities = 18/38 (47%), Positives = 22/38 (57%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIP 180 SII DV G S + C IC +VS + F LSLP+P Sbjct: 172 SIIVDVCQGQYKSTLVCPICKKVSVMFDPFMYLSLPLP 209 >At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 672 Score = 51.6 bits (118), Expect = 4e-07 Identities = 23/58 (39%), Positives = 33/58 (56%) Frame = +3 Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470 +G VSL++CL F + + L+GDN+Y C RC K I P +L + LKRF+ Sbjct: 330 HGDAVSLEECLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQ 387 >At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) almost identical to ubiquitin-specific protease 15 GI:11993475 [Arabidopsis thaliana], 7 amino acid difference Length = 924 Score = 50.4 bits (115), Expect = 9e-07 Identities = 26/58 (44%), Positives = 32/58 (55%) Frame = +3 Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470 YG V SLQD L F ++L G+NMY CSRC K I P +L + LKRF+ Sbjct: 594 YGWVESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQ 651 Score = 35.9 bits (79), Expect = 0.021 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 +++ +F G L S V+CL CD S R E DL+L I Sbjct: 557 TLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEI 593 >At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 892 Score = 50.0 bits (114), Expect = 1e-06 Identities = 24/63 (38%), Positives = 34/63 (53%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 +SL CL AF + + L D+M+ C CK+ R K + LP +L HLKRF + F Sbjct: 733 ISLFSCLEAFLAEEPLGPDDMWYCPGCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYFK 792 Query: 489 XKV 497 K+ Sbjct: 793 NKI 795 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPS 183 S+I DVF G S + C C ++S + F LSLP+PS Sbjct: 443 SVIVDVFQGQYKSTLVCPDCGKISITFDPFMYLSLPLPS 481 >At4g10590.2 68417.m01733 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 910 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/70 (35%), Positives = 35/70 (50%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 +SL CL AF + + L D+M+ C CK+ R K + LP +L HLKRF + Sbjct: 747 ISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLK 806 Query: 489 XKVAARVPSP 518 K+ V P Sbjct: 807 NKIDTFVNFP 816 Score = 34.3 bits (75), Expect = 0.063 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPS 183 S+I DV G S + C C ++S + F LS+P+PS Sbjct: 445 SVIVDVCQGQYKSTLVCPACGKISITFDPFMYLSVPLPS 483 >At4g10590.1 68417.m01732 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 910 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/70 (35%), Positives = 35/70 (50%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 +SL CL AF + + L D+M+ C CK+ R K + LP +L HLKRF + Sbjct: 747 ISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLK 806 Query: 489 XKVAARVPSP 518 K+ V P Sbjct: 807 NKIDTFVNFP 816 Score = 34.3 bits (75), Expect = 0.063 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPS 183 S+I DV G S + C C ++S + F LS+P+PS Sbjct: 445 SVIVDVCQGQYKSTLVCPACGKISITFDPFMYLSVPLPS 483 >At4g10570.1 68417.m01730 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 923 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/70 (35%), Positives = 35/70 (50%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 +SL CL AF + + L D+M+ C CK+ R K + LP +L HLKRF + Sbjct: 748 ISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLK 807 Query: 489 XKVAARVPSP 518 K+ V P Sbjct: 808 NKIDTFVNFP 817 Score = 35.9 bits (79), Expect = 0.021 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPS 183 S+I DV G S + C +C ++S + F LS+P+PS Sbjct: 446 SVIVDVCQGQYKSTLVCPVCGKISITFDPFMYLSVPLPS 484 >At2g32780.1 68415.m04013 ubiquitin-specific protease 1, putative (UBP1) similar to GI:11993461 Length = 1083 Score = 47.6 bits (108), Expect = 6e-06 Identities = 26/60 (43%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +1 Query: 10 NSARAKSG--SSGDGSNVKYRSIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPS 183 +S R K G S D S + ++I VF G + S V CL C S E F DLSLP+PS Sbjct: 303 SSLRKKLGVSDSNDSSTYQKPTLIDSVFGGEISSTVSCLECGHFSKVYEPFMDLSLPVPS 362 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKK 395 VS+ CLA F + L DN + C C K Sbjct: 799 VSVDRCLAQFTKHEILSEDNAWHCENCSK 827 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 47.2 bits (107), Expect = 8e-06 Identities = 26/77 (33%), Positives = 38/77 (49%) Frame = +3 Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476 +G SL++CL F + + L GDNMY C RC K I P +L + LKR++ Sbjct: 324 HGDAGSLEECLDQFTAEEWLHGDNMYKCDRCSDYVKACKRLTIRRAPNILTIALKRYQGG 383 Query: 477 LLFSXKVAARVPSPSTI 527 K+ R+ P T+ Sbjct: 384 RY--GKLNKRISFPETL 398 Score = 33.9 bits (74), Expect = 0.083 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDL 165 ++I +F G L S VQC +C+ VS + E DL Sbjct: 287 TLIQYIFGGLLQSQVQCTVCNHVSDQYENMMDL 319 >At2g40930.1 68415.m05052 ubiquitin-specific protease 5, putative (UBP5) similar to GI:6648604 Length = 924 Score = 47.2 bits (107), Expect = 8e-06 Identities = 25/70 (35%), Positives = 34/70 (48%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 +SL CL AF + L D M+ C +C + R K + LP VL +HLKRF + Sbjct: 768 LSLYACLEAFLREEPLVPDEMWFCPQCNERRQASKKLDLWRLPEVLVIHLKRFSYSRSMK 827 Query: 489 XKVAARVPSP 518 K+ V P Sbjct: 828 HKLETFVNFP 837 Score = 35.1 bits (77), Expect = 0.036 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 SII DV G S + C IC++VS + F LSLP+ Sbjct: 459 SIIVDVCQGQYKSTLVCPICNKVSVTFDPFMYLSLPL 495 >At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 16 (UBP16) [Arabidopsis thaliana] GI:11993477; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 731 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/59 (38%), Positives = 34/59 (57%) Frame = +3 Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476 G + SL++ LA F + + L G+N Y C RCK + K I+ P +L V LKRF+ + Sbjct: 483 GDIGSLEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSD 541 >At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22) almost identical to ubiquitin-specific protease 22 GI:11993484 [Arabidopsis thaliana], one amino acid difference Length = 557 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479 +L CL F +++L D +C C + R K I LP +LC+H+KRF H L Sbjct: 362 TLSGCLDFFTRSEKLGPDQKLNCQSCGEKRESSKQMSIRRLPLLLCLHVKRFEHSL 417 Score = 32.7 bits (71), Expect = 0.19 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 52 NVKYRSIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ 216 N + + I F G L S V C C ST + F D+SL + S + C++ Sbjct: 293 NEECQCITHKAFSGLLRSDVTCTTCGSTSTTYDPFIDISLTLDSMNGFSPADCRK 347 >At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25) similar to GI:11993490 Length = 661 Score = 45.2 bits (102), Expect = 3e-05 Identities = 20/52 (38%), Positives = 30/52 (57%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467 S+++ L FF ++ L G+N Y C C+KL K I+ P +L + LKRF Sbjct: 191 SVKESLQKFFQSEILDGNNKYRCESCEKLVTARKQMSILQAPNILVIQLKRF 242 Score = 34.7 bits (76), Expect = 0.047 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 67 SIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 S++ ++F G L S V+CL C S + + D+SL I Sbjct: 150 SVVKEIFGGALQSQVKCLSCGAESNKADEIMDISLEI 186 >At4g24560.1 68417.m03520 ubiquitin-specific protease 16, putative (UBP16) similar to ubiquitin-specific protease 16 GI:11993477 [Arabidopsis thaliana] Length = 1008 Score = 42.3 bits (95), Expect = 2e-04 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = +3 Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470 G + +L D L F + L G+N Y C CK K I P VL + LKRF+ Sbjct: 699 GDISTLDDALRRFTRTEILDGENKYRCGSCKSYERAKKKLKITEPPNVLTIALKRFQ 755 >At4g39910.1 68417.m05653 ubiquitin-specific protease 3 (UBP3) identical to GI:2347098 Length = 371 Score = 41.9 bits (94), Expect = 3e-04 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473 S+ CL F S + L ++ + C +C L+ K I P +L +HLKRF++ Sbjct: 211 SITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKY 264 Score = 37.5 bits (83), Expect = 0.007 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +1 Query: 73 ISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 + ++F G L + +CL C+ V+ R ETF DLSL I Sbjct: 172 VHNIFQGILTNETRCLRCETVTARDETFLDLSLDI 206 >At2g22310.1 68415.m02647 ubiquitin-specific protease 4 (UBP4) identical to GI:2347100 Length = 365 Score = 41.9 bits (94), Expect = 3e-04 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473 S+ CL F S + L ++ + C +C L+ K I P +L +HLKRF++ Sbjct: 206 SITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKY 259 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 73 ISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 + +F G L + +CL C+ V+ R ETF DLSL I Sbjct: 167 VHKIFQGILTNETRCLRCETVTARDETFLDLSLDI 201 >At5g57990.1 68418.m07255 ubiquitin-specific protease 23, putative (UBP23) identical to GI:11993486 Length = 859 Score = 40.7 bits (91), Expect = 7e-04 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = +1 Query: 28 SGSSGDGSNVKYRSIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195 SG + S+ RS++ +F G L S V+C C S + + F DLSL I + L Sbjct: 212 SGVPSESSDAYRRSLVHKIFGGSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSL 267 Score = 40.7 bits (91), Expect = 7e-04 Identities = 28/73 (38%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +3 Query: 312 SLQDCLAAFFSADEL-KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488 SLQ L+ F + + L G +Y C RCK+ K + P VL VHLKRF E S Sbjct: 266 SLQRALSRFTAVELLDNGAKVYQCERCKQKVKAKKQLTVSKAPYVLTVHLKRF--EAHRS 323 Query: 489 XKVAARVPSPSTI 527 K+ +V S I Sbjct: 324 EKIDRKVDFTSAI 336 >At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2) identical to GI:11993463 Length = 961 Score = 39.1 bits (87), Expect = 0.002 Identities = 22/60 (36%), Positives = 31/60 (51%) Frame = +1 Query: 10 NSARAKSGSSGDGSNVKYRSIISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189 ++ R K G S + K ++I VF G S V C+ C S E F DLSLP+P ++ Sbjct: 332 SALRKKRGVSDNDE--KSTTLIESVFGGETSSIVSCMECGHSSKVYEPFLDLSLPVPFKK 389 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKK 395 VS++ CL F + L DN ++C C K Sbjct: 709 VSVERCLGHFTKHEILSDDNAWNCENCSK 737 >At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) similar to GI:11993492; RNA binding protein - Homo sapiens, EMBL:AB016089 (N-terminus), several ubiquitin carboxyl-terminal hydrolases from aa pos. 712 Length = 1067 Score = 35.5 bits (78), Expect = 0.027 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKR 464 SL L + S ++L GDN Y C C + + + LP V+ LKR Sbjct: 253 SLDASLNDYLSLEQLNGDNQYFCGSCNARVDATRCIKLRTLPPVITFQLKR 303 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +1 Query: 49 SNVKYRSIISDVFDGXLLSAVQCLICDR---VSTRIETFQDLSLPIPSREHL 195 S VK ++I+ D+F G + C C R S+++E F L L + + L Sbjct: 203 SGVKAKTIVQDLFSGSVSHVTTCSKCGRDSEASSKMEDFYALELNVKGLKSL 254 >At4g17895.1 68417.m02667 ubiquitin-specific protease 20, putative (UBP20) identical to ubiquitin-specific protease 20 GI:11993480 [Arabidopsis thaliana] Length = 695 Score = 33.5 bits (73), Expect = 0.11 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +3 Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485 V +L L +F ++L D +C C + + K + LP V HLKRF++ L+ Sbjct: 329 VDTLGSALESFTRVEKL--DEQLTCDNCNEKVSKEKQLLLDKLPLVATFHLKRFKNNGLY 386 Query: 486 SXKVAARVPSPSTI 527 K+ V P I Sbjct: 387 MEKIYKHVKIPLEI 400 Score = 32.3 bits (70), Expect = 0.25 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +1 Query: 79 DVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 DVF G L+S ++C CD VS E LSL I Sbjct: 294 DVFSGRLISGLRCCNCDYVSETYEKSVGLSLEI 326 >At5g06600.2 68418.m00746 ubiquitin-specific protease 12 (UBP12) almost identical to ubiquitin-specific protease 12 GI:11993471 [Arabidopsis thaliana], one amino acid difference Length = 1115 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 73 ISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 I +F+G ++ ++C+ D STR E+F DL L + Sbjct: 305 IQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDV 339 >At5g06600.1 68418.m00745 ubiquitin-specific protease 12 (UBP12) almost identical to ubiquitin-specific protease 12 GI:11993471 [Arabidopsis thaliana], one amino acid difference Length = 1116 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 73 ISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 I +F+G ++ ++C+ D STR E+F DL L + Sbjct: 306 IQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDV 340 >At3g11910.1 68416.m01460 ubiquitin-specific protease, putative strong similarity to ubiquitin-specific protease 12 (UBP12) [Arabidopsis thaliana] GI:11993471; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF00917: MATH domain Length = 1115 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 73 ISDVFDGXLLSAVQCLICDRVSTRIETFQDLSLPI 177 I +F+G ++ ++C+ D STR E+F DL L + Sbjct: 305 IQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDV 339 >At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21) identical to ubiquitin-specific protease 21 GI:11993482 [Arabidopsis thaliana] Length = 732 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/71 (26%), Positives = 32/71 (45%) Frame = +3 Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485 V +L L +F ++L ++ +C CK+ K LP V HLKRF ++ + Sbjct: 322 VNTLWKALESFTCVEKL--EDQLTCDNCKEKVTKEKQLRFDKLPPVATFHLKRFTNDGVT 379 Query: 486 SXKVAARVPSP 518 K+ + P Sbjct: 380 MEKIFDHIEFP 390 >At5g07120.1 68418.m00812 phox (PX) domain-containing protein similar to SP|O60749 Sorting nexin 2 {Homo sapiens}; contains Pfam profile PF00787: PX domain Length = 572 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 25 KSGSSGDGSNVKYRSIISDVFD 90 KS +GD SN YRS +S +FD Sbjct: 33 KSNVNGDKSNSNYRSAMSTLFD 54 >At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (RAP-1) identical to bHLH protein GB:CAA67885 GI:1465368 from [Arabidopsis thaliana] Length = 623 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 322 TVWPPSSAPTNSKATTCTAAPA 387 T+WPP+S T + T T PA Sbjct: 33 TLWPPASTTTTTATTETTPTPA 54 >At5g10120.1 68418.m01172 ethylene insensitive 3 family protein contains Pfam profile: PF04873 ethylene insensitive 3 Length = 471 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = -3 Query: 233 WWXSMGCWQRSTAKCSRDGIGSDKSWNVSILVDTLSHI 120 WW G A R KSW VS+L + H+ Sbjct: 199 WWGEQGAAHEHGAPPYRKPHDLRKSWKVSVLAAVIKHM 236 >At1g02080.1 68414.m00130 transcriptional regulator-related contains Pfam PF04054: CCR4-Not complex component, Not1; contains TIGRFAM TIGR01612: reticulocyte binding protein; similar to General negative regulator of transcription subunit 1 (SP:P25655) {Saccharomyces cerevisiae}; Location of ESTs gb|T44328 and gb|AA395265 Length = 2378 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 191 CSRDGIGSDKSWNVSILVDTLSHIR 117 C + + +SWNV ILVDT+ ++ Sbjct: 297 CIPTELPTPRSWNVDILVDTIKQLQ 321 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,164,239 Number of Sequences: 28952 Number of extensions: 182140 Number of successful extensions: 585 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -