BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0434.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25190.1 68417.m03626 hypothetical protein contains Pfam pro... 28 6.8 At3g19780.1 68416.m02504 expressed protein 28 6.8 >At4g25190.1 68417.m03626 hypothetical protein contains Pfam profile: PF04484 family of unknown function (DUF566) Length = 443 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 308 SQSKEINPVNKAQHFSRYLQNMTLGCDYSN 219 S+S+EIN + F+RYL+ T G SN Sbjct: 88 SRSQEINNGRSRESFARYLEQRTRGSPRSN 117 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = -3 Query: 669 RSPGTLQ---RSIKANFSLRRMARRGKLSDIDGPTSDIV 562 RS G+L+ RSIKA + R++A + KLSDI +DI+ Sbjct: 342 RSSGSLEEMRRSIKALDTFRQVAAQHKLSDIKKWENDIM 380 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,541,201 Number of Sequences: 28952 Number of extensions: 212875 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -