BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0433.Seq (797 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1461 - 27299891-27301870 31 1.4 06_03_0615 - 22761375-22761760,22762218-22765026 30 1.9 01_01_1176 - 9372879-9373097,9373814-9374278,9374372-9375447,937... 29 5.7 >08_02_1461 - 27299891-27301870 Length = 659 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 733 AKRS*TWLPGCIPVRIKKGCT 795 A+R +PGC+PVR+K+G T Sbjct: 35 AEREFMCIPGCVPVRVKRGTT 55 >06_03_0615 - 22761375-22761760,22762218-22765026 Length = 1064 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +3 Query: 468 TPSKETNVFNENVLRCCRPEISAGGGCSS--WNLER-NGSIINVR 593 TP ++ N +N+L C R E G GCS + E NG II V+ Sbjct: 759 TPFQKLNFCVDNILECLRDENVIGKGCSGVVYRAEMPNGEIIAVK 803 >01_01_1176 - 9372879-9373097,9373814-9374278,9374372-9375447, 9375534-9375687,9375783-9375879,9376238-9376374 Length = 715 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +3 Query: 411 LIKRYYGFKVKHHK--HYDGLTPSKETNVFNENVLR 512 L+ +Y+ + K +D PSKE+N F ENVL+ Sbjct: 229 LLNKYFAERYKGRLIVRFDDTNPSKESNEFVENVLK 264 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,651,917 Number of Sequences: 37544 Number of extensions: 427606 Number of successful extensions: 1162 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1162 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -