BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0433.Seq (797 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L34219-1|AAA65123.1| 317|Homo sapiens retinaldehyde-binding pro... 35 0.39 J04213-1|AAA60251.1| 317|Homo sapiens RLBP1 protein. 35 0.39 BC004199-1|AAH04199.1| 317|Homo sapiens retinaldehyde binding p... 35 0.39 >L34219-1|AAA65123.1| 317|Homo sapiens retinaldehyde-binding protein protein. Length = 317 Score = 34.7 bits (76), Expect = 0.39 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +3 Query: 348 NEAWLIRFLRPCKFYPESAYDLIKRYYGFKVKHHKHYDGLTP 473 + + +RF+R KF AY+L++ Y F++++ + +D L+P Sbjct: 92 DSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSP 133 >J04213-1|AAA60251.1| 317|Homo sapiens RLBP1 protein. Length = 317 Score = 34.7 bits (76), Expect = 0.39 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +3 Query: 348 NEAWLIRFLRPCKFYPESAYDLIKRYYGFKVKHHKHYDGLTP 473 + + +RF+R KF AY+L++ Y F++++ + +D L+P Sbjct: 92 DSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSP 133 >BC004199-1|AAH04199.1| 317|Homo sapiens retinaldehyde binding protein 1 protein. Length = 317 Score = 34.7 bits (76), Expect = 0.39 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +3 Query: 348 NEAWLIRFLRPCKFYPESAYDLIKRYYGFKVKHHKHYDGLTP 473 + + +RF+R KF AY+L++ Y F++++ + +D L+P Sbjct: 92 DSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSP 133 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,663,655 Number of Sequences: 237096 Number of extensions: 2333181 Number of successful extensions: 4575 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4575 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9813323168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -