BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0433.Seq (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 5.7 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 7.6 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = +3 Query: 426 YGFKVKHHKHYDGLTPSKETNVFNENVLRCCRPEIS 533 YG+ + + L P T+ +++ ++ RP++S Sbjct: 382 YGYPIGSGGSFPSLYPMATTSPQSQSTIQTLRPQVS 417 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 789 TLFYADRYASWQPS 748 TL + D + SW+PS Sbjct: 96 TLMWTDSHLSWKPS 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,192 Number of Sequences: 438 Number of extensions: 4642 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -