SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesV0430.Seq
         (797 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    23   3.3  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   7.6  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    22   7.6  

>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -2

Query: 154 FNMRRNIGFHL 122
           FN+RR +G+HL
Sbjct: 207 FNLRRRLGYHL 217


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -1

Query: 185 CERMCHCCLF 156
           C  +CHCC F
Sbjct: 743 CFALCHCCDF 752


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 10/44 (22%), Positives = 20/44 (45%)
 Frame = +1

Query: 379 DPEQQIVYLELGCGVGNMIFPLVEEGFTNFFFYACDFSPRAVEL 510
           DP   IVY+    G   +++   +E F        D+ P+ +++
Sbjct: 198 DPVNTIVYMADDKGDALIVYQNSDESFHRLTSNTFDYDPKYIKM 241


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 216,193
Number of Sequences: 438
Number of extensions: 4376
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25246416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -