BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= tesV0430.Seq
(797 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 3.3
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.6
AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 7.6
>DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride
channel protein.
Length = 383
Score = 23.0 bits (47), Expect = 3.3
Identities = 7/11 (63%), Positives = 10/11 (90%)
Frame = -2
Query: 154 FNMRRNIGFHL 122
FN+RR +G+HL
Sbjct: 207 FNLRRRLGYHL 217
>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
protein.
Length = 1370
Score = 21.8 bits (44), Expect = 7.6
Identities = 6/10 (60%), Positives = 7/10 (70%)
Frame = -1
Query: 185 CERMCHCCLF 156
C +CHCC F
Sbjct: 743 CFALCHCCDF 752
>AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly
protein MRJP5 protein.
Length = 598
Score = 21.8 bits (44), Expect = 7.6
Identities = 10/44 (22%), Positives = 20/44 (45%)
Frame = +1
Query: 379 DPEQQIVYLELGCGVGNMIFPLVEEGFTNFFFYACDFSPRAVEL 510
DP IVY+ G +++ +E F D+ P+ +++
Sbjct: 198 DPVNTIVYMADDKGDALIVYQNSDESFHRLTSNTFDYDPKYIKM 241
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 216,193
Number of Sequences: 438
Number of extensions: 4376
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25246416
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -