BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0430.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26200.1 68415.m03146 expressed protein 93 2e-19 At1g54650.1 68414.m06232 expressed protein similar to Actin-bind... 53 3e-07 At3g18000.1 68416.m02288 phosphoethanolamine N-methyltransferase... 33 0.17 At1g73600.2 68414.m08520 phosphoethanolamine N-methyltransferase... 32 0.51 At1g73600.1 68414.m08521 phosphoethanolamine N-methyltransferase... 32 0.51 At5g58000.1 68418.m07256 phosphatase-related weak similarity to ... 29 3.6 At1g48600.2 68414.m05434 phosphoethanolamine N-methyltransferase... 29 4.7 At1g48600.1 68414.m05435 phosphoethanolamine N-methyltransferase... 29 4.7 At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene... 28 6.2 At1g66680.1 68414.m07579 S locus-linked protein, putative simila... 28 8.3 At1g19370.1 68414.m02410 expressed protein 28 8.3 >At2g26200.1 68415.m03146 expressed protein Length = 565 Score = 93.1 bits (221), Expect = 2e-19 Identities = 41/82 (50%), Positives = 57/82 (69%) Frame = +1 Query: 265 RLEKDAKRHWDLFYKRNETKFFRDRHWTTREFQELINFDPEQQIVYLELGCGVGNMIFPL 444 + E+DAK++WD+FYK + +FF+DRH+ +E+ F + V LE+GCG GN IFPL Sbjct: 35 KYERDAKKYWDIFYKHHGDRFFKDRHYLDKEWNSY--FSVSGKSVILEVGCGAGNTIFPL 92 Query: 445 VEEGFTNFFFYACDFSPRAVEL 510 + + + F YACDFSPRAVEL Sbjct: 93 IAT-YPDIFVYACDFSPRAVEL 113 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/47 (44%), Positives = 32/47 (68%) Frame = +3 Query: 507 IVKRNSLYDKNRMKAFCADLTTEDLFENIQENSIDIASLIFVLSASS 647 +VK + Y + R+ AF DLT + L ++I +S+DI ++IFVLSA S Sbjct: 113 LVKAHDEYTETRVCAFACDLTGDGLDKHISPSSVDIVTMIFVLSAVS 159 >At1g54650.1 68414.m06232 expressed protein similar to Actin-binding protein ABP140 (Swiss-Prot:Q08641) [Saccharomyces cerevisiae] Length = 299 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = +1 Query: 292 WDLFYKRNET-KFFRDRHWTTREFQELINFDPEQQIVYLELGCGVGNMIFPLVEEGFTNF 468 W F+ R+ + KFF++R + +EF EL++ ++ LE+GCG G+ + P++ G N Sbjct: 51 WQDFHSRHSSGKFFKERRYLLKEFPELVSCGENSKL--LEIGCGNGSTVLPIL-RGSKNI 107 Query: 469 FFYACDFSPRAV 504 YACD S A+ Sbjct: 108 TVYACDCSSDAL 119 >At3g18000.1 68416.m02288 phosphoethanolamine N-methyltransferase 1 / PEAMT 1 (NMT1) identical to Phosphoethanolamine N-methyltransferase 1 (EC 2.1.1.103) (PEAMT 1) (AtNMT1) (SP:Q9FR44){Arabidopsis thaliana}; strong similarity to phosphoethanolamine N-methyltransferase from [Spinacia oleracea] GI:7407189, [Triticum aestivum] GI:17887465; contains Pfam profile PF01209: methlytransferase, UbiE/COQ5 family Length = 491 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 346 TTREFQELINFDPEQQIVYLELGCGVGNMIFPLVEE 453 TT+EF E +N P Q++ L++GCG+G F + E+ Sbjct: 270 TTKEFVEKMNLKPGQKV--LDVGCGIGGGDFYMAEK 303 >At1g73600.2 68414.m08520 phosphoethanolamine N-methyltransferase 3, putative (NMT3) strong similarity to SP|Q9FR44 Phosphoethanolamine N-methyltransferase 1 (EC 2.1.1.103) (PEAMT 1) (AtNMT1) {Arabidopsis thaliana}; identical to SP|Q9C6B9 Putative phosphoethanolamine N-methyltransferase 3 {Arabidopsis thaliana} Length = 376 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +1 Query: 346 TTREFQELINFDPEQQIVYLELGCGVGNMIFPLVE 450 TT+EF ++++ P Q++ L++GCG+G F + E Sbjct: 283 TTKEFVDMLDLKPGQKV--LDVGCGIGGGDFYMAE 315 >At1g73600.1 68414.m08521 phosphoethanolamine N-methyltransferase 3, putative (NMT3) strong similarity to SP|Q9FR44 Phosphoethanolamine N-methyltransferase 1 (EC 2.1.1.103) (PEAMT 1) (AtNMT1) {Arabidopsis thaliana}; identical to SP|Q9C6B9 Putative phosphoethanolamine N-methyltransferase 3 {Arabidopsis thaliana} Length = 555 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +1 Query: 346 TTREFQELINFDPEQQIVYLELGCGVGNMIFPLVE 450 TT+EF ++++ P Q++ L++GCG+G F + E Sbjct: 334 TTKEFVDMLDLKPGQKV--LDVGCGIGGGDFYMAE 366 >At5g58000.1 68418.m07256 phosphatase-related weak similarity to CTD phosphatase-like 3 [Arabidopsis thaliana] GI:22212705; contains Pfam profiles PF02453: Reticulon, PF00533: BRCA1 C Terminus (BRCT) domain, PF03031: NLI interacting factor Length = 1011 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/39 (28%), Positives = 25/39 (64%) Frame = +2 Query: 149 VEETSSSDTFVHRLKELSQEEIKLLQNQNTRLVPEAKRL 265 +EET S ++H+ L+++EI L++ ++R + ++L Sbjct: 656 LEETGVSFRYIHKEMRLNEDEISRLRDSDSRFLQRQRKL 694 >At1g48600.2 68414.m05434 phosphoethanolamine N-methyltransferase 2, putative (NMT2) very similar to |PEM2_ARATH Putative phosphoethanolamine N-methyltransferase 2 (EC 2.1.1.103) (SP:Q944H0){Arabidopsis thaliana}; very similar to Halotolerance protein Hal3b (SP:P94063)[Arabidopsis thaliana]; to similar to GB:AAF61950 from [Spinacia oleracea] Length = 491 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 346 TTREFQELINFDPEQQIVYLELGCGVGNMIFPLVE 450 TT+EF ++ P Q++ L++GCG+G F + E Sbjct: 270 TTKEFVAKMDLKPGQKV--LDVGCGIGGGDFYMAE 302 >At1g48600.1 68414.m05435 phosphoethanolamine N-methyltransferase 2, putative (NMT2) very similar to |PEM2_ARATH Putative phosphoethanolamine N-methyltransferase 2 (EC 2.1.1.103) (SP:Q944H0){Arabidopsis thaliana}; very similar to Halotolerance protein Hal3b (SP:P94063)[Arabidopsis thaliana]; to similar to GB:AAF61950 from [Spinacia oleracea] Length = 475 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 346 TTREFQELINFDPEQQIVYLELGCGVGNMIFPLVE 450 TT+EF ++ P Q++ L++GCG+G F + E Sbjct: 254 TTKEFVAKMDLKPGQKV--LDVGCGIGGGDFYMAE 286 >At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis repressor; identical to COP1 regulatory protein/FUSCA protein FUS1 GI:402685 SP:P43254 Length = 675 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/70 (25%), Positives = 28/70 (40%), Gaps = 7/70 (10%) Frame = +1 Query: 247 TRSKATRLEKDAKRHWDLFYKRNETKFF-------RDRHWTTREFQELINFDPEQQIVYL 405 TR E+ KR W + + R E + + W TR+ +IN D + I + Sbjct: 452 TRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCV 511 Query: 406 ELGCGVGNMI 435 + G N I Sbjct: 512 KYNPGSSNYI 521 >At1g66680.1 68414.m07579 S locus-linked protein, putative similar to S locus-linked protein SLL2 [Brassica napus] GI:1518113 Length = 358 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +1 Query: 403 LELGCGVGNMIFPLVEEGFTNFFFYACDFSPRAVELS 513 L+LG G G ++ L +EGF++ D+S AVEL+ Sbjct: 174 LDLGTGNGLLLHQLAKEGFSD--LTGTDYSDGAVELA 208 >At1g19370.1 68414.m02410 expressed protein Length = 605 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 125 METDIPAHVEETSSSDTFVHRLKELSQEEIKLLQNQNTRL 244 + TD+ V ET+ +H L+EL + +L+ N + +L Sbjct: 39 VSTDVAVSVSETNREAVLLHNLEELVKNLTELVANLDAKL 78 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,565,523 Number of Sequences: 28952 Number of extensions: 341453 Number of successful extensions: 940 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -