BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0429.Seq (844 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 1.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 2.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 2.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 2.0 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 2.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.2 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 8.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 8.1 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 24.2 bits (50), Expect = 1.5 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 416 VDSVLDVVRKEAEGCDCLQG 475 +DS+++++R + CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 1.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 325 PKRPGTDGVHGSRLKVHH 272 P+ PGT ++ ++LK HH Sbjct: 139 PREPGTPRINFTKLKRHH 156 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 350 RSCPVGRFAQTARNGRSPWFQAQGPPSQLAG 258 ++CP + A+ G P GP ++L G Sbjct: 262 QACPTPEYRWYAQTGSEPMLVLSGPRTRLLG 292 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/50 (24%), Positives = 21/50 (42%) Frame = -1 Query: 430 QYRINQFSPLCVMSFRPVIPRLRLSEDEVVRSEDLPKRPGTDGVHGSRLK 281 Q+ SP+ S+ P P ++ DE+ + L +DG + K Sbjct: 127 QHNNGYASPMSTSSYDPYSPNSKIGRDELSQPGSLNGYGSSDGCDARKKK 176 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 350 RSCPVGRFAQTARNGRSPWFQAQGPPSQLAG 258 ++CP + A+ G P GP ++L G Sbjct: 262 QACPTPEYRWYAQTGSEPMLVLSGPRTRLLG 292 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.4 bits (48), Expect = 2.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 195 DSDLQLERINVYYNEASGGKTSREL*W 275 D+ L+ I Y N+ GG+ R+L W Sbjct: 72 DARLKFSNIAPYLNQIYGGQFVRDLIW 98 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 157 TSTALTPRVLTAATPTCSLNASMST 231 T+T T T TP + NAS +T Sbjct: 664 TTTTTTTTTTTTTTPNTTQNASATT 688 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 6.2 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 541 IREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVEN 663 +R I + F ++ +PKVS+ ATLS +++ N Sbjct: 538 VRTPTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHN 578 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 4 FFLHDQILESVYL 42 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 4 FFLHDQILESVYL 42 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 259,972 Number of Sequences: 438 Number of extensions: 6342 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -