BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0426.Seq (797 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.1 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 8.6 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 416 RILRSLLIDMKEEKQKKRNSLSSTWSD 336 ++L S + + EEK K SL + WS+ Sbjct: 210 KLLTSKIYKVLEEKYKTSGSLYTCWSE 236 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +3 Query: 222 FNISVIKIYSFPETFFSISFFGTKLYLSRHIKVF 323 FN + K+ F F FFGT S+ F Sbjct: 72 FNFATKKLEQFIVRFMKYHFFGTLKLWSQLFSTF 105 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,115 Number of Sequences: 336 Number of extensions: 3114 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -