BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0426.Seq (797 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.04c |hsp90|swo1|heat shock protein Hsp90|Schizosaccharom... 29 0.77 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 28 1.8 SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccha... 27 2.4 SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Sc... 27 2.4 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 27 3.1 SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp... 26 5.4 SPAC144.06 |apl5||AP-3 adaptor complex subunit Apl5 |Schizosacch... 26 7.2 >SPAC926.04c |hsp90|swo1|heat shock protein Hsp90|Schizosaccharomyces pombe|chr 1|||Manual Length = 704 Score = 29.1 bits (62), Expect = 0.77 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 386 KEEKQKKRNSLSSTWSDNVIQKDFYVPGEVKFSA 285 KEE SL++ W D++ K F V G+++F A Sbjct: 281 KEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFRA 314 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 27.9 bits (59), Expect = 1.8 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +1 Query: 670 DRVGKIFDTIRKTSLQPILSSKALEWGSLSLTAFISGFS 786 D+VGKI ++ SL LSS LE LS S FS Sbjct: 335 DKVGKIDALFKEISLDIFLSSSTLESLQLSAALLYSTFS 373 >SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccharomyces pombe|chr 2|||Manual Length = 605 Score = 27.5 bits (58), Expect = 2.4 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -1 Query: 440 RTGLFLSHRILRSLLIDMKEEKQKKRNSLSSTWSDNVIQKDFYVPG 303 R G S R SL +DMK+ +K R SL + N I PG Sbjct: 90 RLGRSTSSRSRNSLNLDMKDPSEKPRRSLPTAAGQNNIGSPPTPPG 135 >SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Schizosaccharomyces pombe|chr 1|||Manual Length = 564 Score = 27.5 bits (58), Expect = 2.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 623 QCSSEAVVKISKSESAERYGYNHRESDAPPHE 528 Q S+ + S S R +N E +PPHE Sbjct: 135 QIVSDTTTETSNGTSRRRSSHNQHEDSSPPHE 166 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 27.1 bits (57), Expect = 3.1 Identities = 9/20 (45%), Positives = 18/20 (90%) Frame = -3 Query: 150 ALFSIIDDVLEFNCLSINLL 91 A+FS++DD+++FN L+ ++L Sbjct: 967 AIFSVLDDIVDFNHLTWSIL 986 >SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 361 TAYHRLGRIMLFRKTF 314 T YHRLGRI+ RK F Sbjct: 469 TLYHRLGRILRERKLF 484 >SPAC144.06 |apl5||AP-3 adaptor complex subunit Apl5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 834 Score = 25.8 bits (54), Expect = 7.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 653 CRRERTS*DDQCSSEAVVKISKSE 582 CR+E TS D SEA++K++ E Sbjct: 32 CRKEATSQDADLKSEAILKLAYLE 55 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,878,593 Number of Sequences: 5004 Number of extensions: 54645 Number of successful extensions: 151 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -