BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0424.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 35 6e-04 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 35 6e-04 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 27 0.11 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 35.1 bits (77), Expect = 6e-04 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +3 Query: 597 NXPTAAALRVRSRQEPQGERNVLIFVLGGG 686 N PTAAA+ ++ + ERNVLIF LGGG Sbjct: 2 NEPTAAAIAYGLDKKAEKERNVLIFDLGGG 31 Score = 21.0 bits (42), Expect = 9.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 604 PQPPRXAYGLDKNLKVREMFLSSFWVEGTFD 696 P AYGLDK + L GTFD Sbjct: 4 PTAAAIAYGLDKKAEKERNVLIFDLGGGTFD 34 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 35.1 bits (77), Expect = 6e-04 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +3 Query: 597 NXPTAAALRVRSRQEPQGERNVLIFVLGGG 686 N PTAAA+ ++ + ERNVLIF LGGG Sbjct: 2 NEPTAAAIAYGLDKKAERERNVLIFDLGGG 31 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 27.5 bits (58), Expect = 0.11 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 597 NXPTAAALRVRSRQEPQGERNVLIFVLGGG 686 N PTAAA+ + E+N+L++ LGGG Sbjct: 2 NEPTAAAIAY-GLDKKGAEQNILVYDLGGG 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,288 Number of Sequences: 336 Number of extensions: 3104 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -