BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0424.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 4.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 6.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 6.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 6.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.8 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 318 DPKIQQDMKHWPF 356 DP + +D +HW F Sbjct: 855 DPAVYEDWRHWKF 867 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 4.9 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +3 Query: 519 GILQRLPASGHQGRRSHSRLKRARIXNXPTAAALRVRSRQEPQGE 653 GI Q ASG R HS L R A +R + + P GE Sbjct: 629 GIYQHNVASGLTKARGHSLLVADRPNFVTILALVRDATARLPNGE 673 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +3 Query: 156 RGDHRERXGQPHHTIVRRVHGHGA 227 R R R PH R+HG+ + Sbjct: 599 RRQERMRYAAPHKAFTYRMHGYAS 622 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.4 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +3 Query: 219 HGASHRRRSQEPVALNPNNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVINDCGKPKI 389 H + R E AL+ ++F L+G DP I + +K + C KP++ Sbjct: 174 HDPEYSARENELRALS---SLFSKGCLVGTWSPDPAINRRLKETYSNMCALCEKPEV 227 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.4 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +3 Query: 219 HGASHRRRSQEPVALNPNNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVINDCGKPKI 389 H + R E AL+ ++F L+G DP I + +K + C KP++ Sbjct: 174 HDPEYSARENELRALS---SLFSKGCLVGTWSPDPAINRRLKETYSNMCALCEKPEV 227 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.4 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +3 Query: 219 HGASHRRRSQEPVALNPNNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVINDCGKPKI 389 H + R E AL+ ++F L+G DP I + +K + C KP++ Sbjct: 174 HDPEYSARENELRALS---SLFSKGCLVGTWSPDPAINRRLKETYSNMCALCEKPEV 227 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,360 Number of Sequences: 438 Number of extensions: 4071 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -