BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0421.Seq (852 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 2.0 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 23 4.7 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 23 4.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 4.7 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 23 4.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 8.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 8.2 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 81 LREKAFQDYRKKLMEHKEVESR 146 +RE+ + YR+ L+EHK+ +R Sbjct: 139 IREQTEEMYREMLLEHKKRRAR 160 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 Query: 736 AGPPTLASYHGRDRCHSVGDVFPKARSAGSRR 831 +GP L + D C D+ P SAG + Sbjct: 44 SGPNELGRFKHTDACCRTHDMCPDVMSAGESK 75 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 Query: 736 AGPPTLASYHGRDRCHSVGDVFPKARSAGSRR 831 +GP L + D C D+ P SAG + Sbjct: 49 SGPNELGRFKHTDACCRTHDMCPDVMSAGESK 80 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.6 bits (46), Expect = 4.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 645 SSCEATAPREQSLSCTRRSVQQTSFGWSDTDSN 547 SSC A +L RRSV + S G + + S+ Sbjct: 154 SSCGPGAAAAAALLSKRRSVSECSLGTASSTSS 186 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 Query: 736 AGPPTLASYHGRDRCHSVGDVFPKARSAGSRR 831 +GP L + D C D+ P SAG + Sbjct: 49 SGPNELGRFKHTDACCRTHDMCPDVMSAGESK 80 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 8.2 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -3 Query: 850 PIRVRWISSNRRFVPSEKRLPPNGIDLVHDMMQGLVVPRVVEHL-PDEAARFTDVLVN 680 P+ + W+ R PSE R+ +D + ++ ++EHL PD ++ V N Sbjct: 640 PLSISWLKDGRAMGPSE-RVHVTNMDQYNSIL-------MIEHLSPDHNGNYSCVARN 689 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 8.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 91 RPSRITERSSWSIRKSSHDSKKVVTN*KI*PNNMTRVK 204 +P + RS+ + + D+ VVT K +N+T K Sbjct: 983 KPPSVVSRSTQTSANNDKDTNAVVTQSKEARDNITATK 1020 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,679 Number of Sequences: 438 Number of extensions: 5302 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -