BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0419.Seq (797 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.1 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 4.9 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 6.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 6.5 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 8.6 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.1 Identities = 25/95 (26%), Positives = 37/95 (38%), Gaps = 9/95 (9%) Frame = -1 Query: 491 PICCNIWLMFIN*ELARQYLYGGAH----GLTCSKGRGSSCS*FTSLFSPNSS-----MK 339 P CN + + EL +QY GG H C + + C P++S K Sbjct: 1112 PHNCNAYYRCVLGELRKQYCAGGLHWNKERKICDWPKSAKCEEKKPGHKPSTSSWQKPTK 1171 Query: 338 TRHGPPSGLISWM*QWKGTGCSDSNLHKT*LQLVE 234 + PPS W Q K T + + T QL++ Sbjct: 1172 PSYRPPSTTNHW--QTKTTTSTTTRPTTTVSQLID 1204 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 502 VSCCLFAATFGLCSSIESWPG 440 +SC F + C++ SWPG Sbjct: 19 LSCKDFDTLYRDCTTASSWPG 39 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 629 LVFRYSVNVRFLCHSPGFGRFGTFIRAFD 543 L FRY VN HS T+I A D Sbjct: 133 LGFRYLVNDELSAHSKEIRGENTYILALD 161 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 629 LVFRYSVNVRFLCHSPGFGRFGTFIRAFD 543 L FRY VN HS T+I A D Sbjct: 447 LGFRYLVNDELSAHSKEIRGENTYILALD 475 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 517 VSQGSLKMMSKALIKVPNL 573 V+QG+LK + +K PNL Sbjct: 74 VNQGNLKKFNALKLKNPNL 92 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 8.6 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = +2 Query: 206 YGPRYSDGTTLQVGVKSYVNWNPNSLFPSTVTSKK*DLMVARALSSLKNWGKR 364 YGP S + VK + P+ + +SKK R++ + GKR Sbjct: 203 YGPEKSASIPKKKEVKEEIEDEPDHKWKKNDSSKKKTRYYYRSVDDVIEKGKR 255 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,812 Number of Sequences: 336 Number of extensions: 4564 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -