BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0419.Seq (797 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0626 - 5445676-5446687,5447099-5447430 29 5.7 06_03_0754 + 24190778-24191284,24191735-24191784,24192311-241923... 28 7.5 03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539,117... 28 9.9 >08_01_0626 - 5445676-5446687,5447099-5447430 Length = 447 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/50 (24%), Positives = 26/50 (52%) Frame = +3 Query: 498 ETKNGIGKPRKSKDDVKSPDKGSKSPKTWTVTEETDIY*ISENKPYFHIM 647 E KN + + + +D + D +++ + W V + D + I+EN P ++ Sbjct: 259 EDKNDVVEEEEDEDMDEGEDDENETNEEWEVRKNKDAFAIAENMPELRLL 308 >06_03_0754 + 24190778-24191284,24191735-24191784,24192311-24192383, 24192577-24192717,24193635-24194039,24194215-24194319, 24194635-24194775,24195330-24195533,24196206-24196292, 24196689-24196800,24197972-24198015 Length = 622 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 104 GITPFPYKVAKALDPDIYRNIEFDVWSEMRRELRYGP 214 G++ + A LDPD++ N W E + +Y P Sbjct: 521 GVSDVQAESATCLDPDLFTNFLIPSWFEAQGPTKYNP 557 >03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539, 1178179-1178378,1178505-1178605,1178747-1179369, 1179451-1179546,1179637-1179798,1179889-1180068, 1180173-1180323,1180408-1180641,1180753-1180913, 1181041-1181163,1181261-1181421,1181655-1181877, 1181952-1182346,1182461-1182671,1183536-1184522 Length = 1883 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 26 NRSLIQLENVCLNCLNINSAKDLFDNGITPFPYKVAKALDPDI 154 N I+L +NC+N+ ++KD F ++ F LD ++ Sbjct: 955 NSQFIKLYMYSVNCVNVGTSKDPFVTQLSNFAIIFGNELDAEV 997 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,947,749 Number of Sequences: 37544 Number of extensions: 501518 Number of successful extensions: 1265 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -