BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0414.Seq (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21330| Best HMM Match : JmjC (HMM E-Value=0.0054) 29 4.1 SB_14830| Best HMM Match : NADH5_C (HMM E-Value=1.1) 28 7.2 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_21330| Best HMM Match : JmjC (HMM E-Value=0.0054) Length = 304 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +1 Query: 79 IKTKNVDAVFVEKQKKILSFFQDVSQLNTDD-EYYKIGKD---YDIEM 210 I + ++A +EK K++L FF + N +D EY I + Y +EM Sbjct: 227 ILKEEIEAFSIEKMKEVLLFFDPIDVSNMEDFEYSHINAEDIMYSLEM 274 >SB_14830| Best HMM Match : NADH5_C (HMM E-Value=1.1) Length = 175 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 556 HLCYVNFLQHFHIHKHLGYTSY 491 H Y + HFH+H HL Y +Y Sbjct: 99 HYHYNHHHHHFHLHHHLHYQNY 120 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 217 PYSFRYHSLCQF-YNIHHQCLVGSHLGRRTEFSFAFQQIRHP 95 P+S+R C+F +H+ CL +H + EF + + P Sbjct: 68 PFSYRNKVFCRFDAAVHYDCLYVTHKKKHVEFRWLHIEFLQP 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,478,688 Number of Sequences: 59808 Number of extensions: 408639 Number of successful extensions: 803 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -