BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0408.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.2 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.7 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 9.7 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 4.2 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -1 Query: 449 GAPTPSQCISSVRIWRV*TIPRTCRFVDV*TSLVSSPRT 333 GAP+PS SS+ R T T V TS S P T Sbjct: 73 GAPSPSSTPSSLPTQRTSTSNPTYSSRSVMTSCSSVPTT 111 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 386 LESFIRAKYEQKKYIAKEWVP 448 L F++ + KY+ EWVP Sbjct: 77 LLEFVQIDPHRWKYVNGEWVP 97 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 434 KEWVPPQLPKVNWDKEIDEEMD 499 K + PP+LP V E + E+D Sbjct: 136 KPYTPPRLPTVYGKPEQNYEVD 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,541 Number of Sequences: 336 Number of extensions: 3822 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -