BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0403.Seq (777 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 2.1 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 4.8 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/29 (37%), Positives = 20/29 (68%), Gaps = 4/29 (13%) Frame = -2 Query: 548 YNSYDRKY*NAHL----IVLKSNLQLNNY 474 Y+ Y+R+Y NAHL +V+++ L ++ Y Sbjct: 49 YSVYERRYMNAHLSGIQLVVRNLLDISLY 77 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -2 Query: 419 LHYYVRFVT*LFHNYFTHFMQETSEILMYK 330 +H +VR+V + F +F+Q E Y+ Sbjct: 134 IHLFVRYVFVTSYLLFDYFVQRNQEYKYYQ 163 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,207 Number of Sequences: 336 Number of extensions: 2361 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -