BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0403.Seq (777 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39853-6|AAM54193.2| 1632|Caenorhabditis elegans Hypothetical pr... 30 2.1 Z75955-3|CAB00114.1| 461|Caenorhabditis elegans Hypothetical pr... 29 2.8 >U39853-6|AAM54193.2| 1632|Caenorhabditis elegans Hypothetical protein F13B9.1a protein. Length = 1632 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 155 PTPLAQ-GPVPGPXRTGALRAXRGXEQRARV 66 P P+AQ GP P P G LRA RG + ARV Sbjct: 1544 PPPMAQAGPAP-PVGGGGLRAARGASRYARV 1573 >Z75955-3|CAB00114.1| 461|Caenorhabditis elegans Hypothetical protein R07B7.5 protein. Length = 461 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/63 (28%), Positives = 29/63 (46%) Frame = -1 Query: 378 LFHTFHAGNVRNINV*TQRTRDYTVTIILNYVHRSRXXXKIQDELLFFQLNLHXAFDCIS 199 +FH + G+ I + R + +TVTI + + +D L FF+ N AF + Sbjct: 222 VFHLWPRGHFTLIAL-ANRDKTFTVTIFAPFSEFEKHMSTSEDVLSFFEENFPDAFLLLG 280 Query: 198 LEH 190 EH Sbjct: 281 KEH 283 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,863,021 Number of Sequences: 27780 Number of extensions: 211161 Number of successful extensions: 404 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1872168044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -