BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0403.Seq (777 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 9.7 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 9.7 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -2 Query: 425 ITLHYYVRFVT*LFHNYFTHFMQETSEILMYK 330 + +H Y V+ H F HF Q + +K Sbjct: 134 LAMHDYPPLVSGALHLLFRHFSQRQEVLQAFK 165 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -2 Query: 425 ITLHYYVRFVT*LFHNYFTHFMQETSEILMYK 330 + +H Y V+ H F HF Q + +K Sbjct: 102 LAMHDYPPLVSGALHLLFRHFSQRQEVLQAFK 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,907 Number of Sequences: 438 Number of extensions: 2902 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -