BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0400.Seq (796 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 1.2 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 26 1.2 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 26 1.5 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 24 4.7 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 4.7 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 4.7 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 24 6.2 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 24 6.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 10 HSILYNFSCPSTNFNTLNQYGRSKSASRRHWSTKRHPSLESSHH 141 HS+ Y +++F + Y ++ STKR P E S++ Sbjct: 2079 HSLRYPMDSAASSFTLIYDYNKNGEVKSIKESTKRVPMFEFSYN 2122 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 26.2 bits (55), Expect = 1.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 724 PRGVREPCCGCTVP 683 P+ +REPC GC P Sbjct: 230 PKNLREPCPGCVAP 243 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 25.8 bits (54), Expect = 1.5 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +3 Query: 234 CRHSTKRTRERCDFSAAATSKNSSTRDLPLAGFHGEVLPGGQRSLFILFTH 386 C H T RT+ D SA N+ + P+ H G +++ FT+ Sbjct: 211 CNHYTHRTKVTSDISAGPCRTNTKSSSDPVLN-HDTTNTGIAEKVWLYFTN 260 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 784 KPGSQGPRPPKGRFLES 734 +PG GP PP GR S Sbjct: 449 QPGRMGPPPPTGRLFVS 465 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 367 YLFYSLIFMNVVPNLLILVPIFLFALLHAAS 459 Y ++L+FM ++P LLIL+ +L + +S Sbjct: 349 YTTFTLVFMFIIP-LLILIGTYLSTFMTISS 378 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 367 YLFYSLIFMNVVPNLLILVPIFLFALLHAAS 459 Y ++L+FM ++P LLIL+ +L + +S Sbjct: 350 YTTFTLVFMFIIP-LLILIGTYLSTFMTISS 379 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 6.2 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = +1 Query: 289 HQRIPAREISLSRDFMAR--FFLEDSAHY---LFYSLIFMNVVPNLLILVPIFLFAL 444 + R+ +R SL R++ R +L ++ L+YSL+ NV + L L+P + L Sbjct: 82 YARVVSRVKSLQREYADRNPIYLNAGDNFQGTLWYSLLRWNVTAHFLNLLPADVMTL 138 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 6.2 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = +1 Query: 289 HQRIPAREISLSRDFMAR--FFLEDSAHY---LFYSLIFMNVVPNLLILVPIFLFAL 444 + R+ +R SL R++ R +L ++ L+YSL+ NV + L L+P + L Sbjct: 82 YARVVSRVKSLQREYADRNPIYLNAGDNFQGTLWYSLLRWNVTAHFLNLLPADVMTL 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 857,511 Number of Sequences: 2352 Number of extensions: 19185 Number of successful extensions: 42 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -