BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0398.Seq (855 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04940.1 68417.m00718 transducin family protein / WD-40 repea... 33 0.32 At4g35680.1 68417.m05065 expressed protein contains Pfam profile... 31 0.74 At2g37160.1 68415.m04559 transducin family protein / WD-40 repea... 31 0.74 At2g38020.1 68415.m04667 vacuoleless1 (VCL1) contains Pfam profi... 31 0.98 At4g21970.1 68417.m03180 expressed protein contains Pfam profile... 31 1.3 At1g73720.1 68414.m08536 transducin family protein / WD-40 repea... 31 1.3 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 30 1.7 At5g11240.1 68418.m01313 transducin family protein / WD-40 repea... 29 3.0 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 29 3.0 At1g15440.2 68414.m01856 transducin family protein / WD-40 repea... 29 3.0 At1g15440.1 68414.m01855 transducin family protein / WD-40 repea... 29 3.0 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 29 3.0 At5g64730.1 68418.m08140 transducin family protein / WD-40 repea... 29 3.9 At5g14050.1 68418.m01644 transducin family protein / WD-40 repea... 29 3.9 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 29 3.9 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 29 3.9 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 29 3.9 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 29 3.9 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 29 3.9 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 29 5.2 At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 ... 29 5.2 At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regul... 28 6.9 At4g14310.2 68417.m02205 peroxisomal membrane protein-related co... 28 6.9 At4g14310.1 68417.m02204 peroxisomal membrane protein-related co... 28 6.9 At3g53390.1 68416.m05892 transducin family protein / WD-40 repea... 28 6.9 At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regul... 28 6.9 At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 28 9.1 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 28 9.1 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 28 9.1 At1g18830.1 68414.m02345 transducin family protein / WD-40 repea... 28 9.1 At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10... 28 9.1 At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10... 28 9.1 >At4g04940.1 68417.m00718 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats Length = 910 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLHLTSPPTCL 145 FSEDGK+ + + DG L+IWD V+ + +H+ P T L Sbjct: 565 FSEDGKWVISSSMDGSLRIWD----VILAKQIDGVHVDVPITAL 604 >At4g35680.1 68417.m05065 expressed protein contains Pfam profile PF03087: Arabidopsis protein of unknown function Length = 503 Score = 31.5 bits (68), Expect = 0.74 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = +3 Query: 483 RHKNYTTQSHKKSRYLVTASYQLSLWRLHNKDVTLIKSLGYSTSQTAILSLVSFNDTY 656 R + ++ H S L TA +LS+WR + +++ S GY +T ++ LV+ + Y Sbjct: 19 RSASLPSRIHPLSVKLRTALSRLSIWRRSSSSISVSASFGY---ETVLVGLVNLTELY 73 >At2g37160.1 68415.m04559 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 544 Score = 31.5 bits (68), Expect = 0.74 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVL 94 FS DG Y +T+ +DG L+I+D T L Sbjct: 311 FSNDGAYLATVGRDGYLRIFDFSTQKL 337 >At2g38020.1 68415.m04667 vacuoleless1 (VCL1) contains Pfam profiles: PF04841 Vps16, N-terminal region, PF04840: Vps16, C-terminal region; identical to cDNA VCL1 (VCL1) GI:13877132 Length = 858 Score = 31.1 bits (67), Expect = 0.98 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 17 SEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLHLTSPPTCLQW 151 S +GK+ + T DGR+ + D ET + +Y+ + L PP + W Sbjct: 249 SPNGKFLTLFTHDGRIVVVDMETKQIAIDYSCESAL--PPQQMAW 291 >At4g21970.1 68417.m03180 expressed protein contains Pfam profile PF04520: Protein of unknown function, DUF584; expression supported by MPSS Length = 181 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 313 AKHFSAKVTALDWSRKYGLYSCTKDSRVYEWNIED 417 AK SA + DWS+ YG S ++ W I+D Sbjct: 56 AKQSSAPMNIPDWSKVYGYSKKNTSSHLHSWAIDD 90 >At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8)[Drosophila melanogaster] Length = 511 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWDTETNVLKQEYTP 112 A+F+ DG T + D +K+WD++T Q + P Sbjct: 353 AIFTSDGSRIITASSDCTVKVWDSKTTDCLQTFKP 387 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWDTETNVLKQE 103 A FS DG++ ++ + DG +++WD + LK++ Sbjct: 219 ARFSPDGQFLASSSVDGFIEVWDYISGKLKKD 250 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 30.3 bits (65), Expect = 1.7 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 2/99 (2%) Frame = +1 Query: 148 VDNRQSISFELKREPKQFKCEYKRK*VPMHSIRHYNGKLLIYSISQ-AKIINVWVPAKHF 324 V R+ +FE P C + ++ + +GK+ + ++ P K Sbjct: 483 VSGRKHFTFEGHDAPVYSICPHYKENIQFIFSTAIDGKIKAWLYDNLGSRVDYDAPGKWC 542 Query: 325 SAKVTALDWSRKYGL-YSCTKDSRVYEWNIEDGSVKQTY 438 + + + D +R + S DS + EWN +GS+K+TY Sbjct: 543 TRMLYSADGTRLFSCGTSKDGDSFLVEWNESEGSIKRTY 581 >At5g11240.1 68418.m01313 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); similar to uncharacterized protein KIAA0007 (GI:1663708) {Homo sapiens} 1.2e-11 Length = 615 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEY 106 FS Y + T DGR+KIWDT ++ E+ Sbjct: 13 FSPALDYLALSTGDGRIKIWDTVKGQVQTEF 43 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIW 73 FS DGKY +T +DG +KIW Sbjct: 206 FSPDGKYLATGGEDGVVKIW 225 >At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 860 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVL 94 F DGK ++ T DG++ WDT VL Sbjct: 527 FRPDGKQLASSTLDGQINFWDTIEGVL 553 >At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 900 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVL 94 F DGK ++ T DG++ WDT VL Sbjct: 567 FRPDGKQLASSTLDGQINFWDTIEGVL 593 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTET 85 FS DG + T D +K WDTET Sbjct: 334 FSNDGSKFLTAGYDKNIKYWDTET 357 >At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8) [Fruit fly] {Drosophila m.] Length = 299 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWDTETNVLKQEY------TPDLHLTS 130 A F+ DG Y T KD +++W+ +L + Y D+H+TS Sbjct: 24 ARFNGDGNYALTCGKDRTIRLWNPHRGILIKTYKSHGREVRDVHVTS 70 >At5g14050.1 68418.m01644 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to unknown protein (ref|NP_057085.1) Length = 546 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTET 85 FSEDGK+ + DG++ +WD T Sbjct: 382 FSEDGKHLLSSGGDGQVYVWDLRT 405 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLH 121 FS DGK ++ D ++ IW+ ET L+ E TP+ H Sbjct: 516 FSYDGKLLASAGHDKKVFIWNMET--LQVESTPEEH 549 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLH 121 FS DGK ++ D ++ IW+ ET L+ E TP+ H Sbjct: 518 FSYDGKLLASAGHDKKVFIWNMET--LQVESTPEEH 551 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLH 121 FS DGK ++ D ++ IW+ ET L+ E TP+ H Sbjct: 518 FSYDGKLLASAGHDKKVFIWNMET--LQVESTPEEH 551 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLH 121 FS DGK ++ D ++ IW+ ET L+ E TP+ H Sbjct: 518 FSYDGKLLASAGHDKKVFIWNMET--LQVESTPEEH 551 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLH 121 FS DGK ++ D ++ IW+ ET L+ E TP+ H Sbjct: 518 FSYDGKLLASAGHDKKVFIWNMET--LQVESTPEEH 551 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 5 EAMFSEDGKYYSTITKDGRLKIWDTETNVLKQE 103 + +S D + + +KD LKIW+ T LKQ+ Sbjct: 407 QVSWSADSRLLLSGSKDSTLKIWEIRTKKLKQD 439 >At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI2 (SP:O22468) [Arabidopsis thaliana] WD-40 repeats (PF0400); Length = 415 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 35 YSTITKDGRLKIWDTETNVLKQE 103 + + +DGRL IWDT TN ++ + Sbjct: 233 FGSAGEDGRLVIWDTRTNQMQHQ 255 >At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regulator 1 (PRL1) identical to PP1/PP2A phosphatases pleiotropic regulator PRL1 (SP:Q42384) [Arabidopsis thaliana], PRL1 [Arabidopsis thaliana] GI:577733; contains Pfam PF00400: WD domain, G-beta repeat (7 copies) Length = 486 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYT 109 F +++ T + D +KIWD T VLK T Sbjct: 184 FDPSNEWFCTGSADRTIKIWDVATGVLKLTLT 215 >At4g14310.2 68417.m02205 peroxisomal membrane protein-related contains weak similarity to Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein) (Swiss-Prot:P42925) [Mus musculus] Length = 965 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 379 TKDSRVYEWNIEDGS--VKQTYNISIENNTKQGSNINAIKIIPHNR 510 TKD + +IEDGS V +T + NNT G N A ++P + Sbjct: 634 TKDIKAL--HIEDGSSRVSRTALAPLPNNTSHGRNTPACAVVPETQ 677 >At4g14310.1 68417.m02204 peroxisomal membrane protein-related contains weak similarity to Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein) (Swiss-Prot:P42925) [Mus musculus] Length = 1087 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 379 TKDSRVYEWNIEDGS--VKQTYNISIENNTKQGSNINAIKIIPHNR 510 TKD + +IEDGS V +T + NNT G N A ++P + Sbjct: 607 TKDIKAL--HIEDGSSRVSRTALAPLPNNTSHGRNTPACAVVPETQ 650 >At3g53390.1 68416.m05892 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 558 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVL 94 FS DG + +T+ +DG L+I+D T L Sbjct: 311 FSNDGAHLATVGRDGYLRIFDFLTQKL 337 >At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regulator 2 (PRL2) identical to SP|Q39190 PP1/PP2A phosphatases pleiotropic regulator PRL2 {Arabidopsis thaliana}, GB:Q39190 from [Arabidopsis thaliana]; contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 1 weak) Length = 479 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYT 109 F +++ T + D +KIWD T VLK T Sbjct: 178 FDPSNEWFCTGSADRTIKIWDVATGVLKLTLT 209 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.9 bits (59), Expect = 9.1 Identities = 19/99 (19%), Positives = 45/99 (45%), Gaps = 2/99 (2%) Frame = +1 Query: 148 VDNRQSISFELKREPKQFKCEYKRK*VPMHSIRHYNGKLLIYSISQA-KIINVWVPAKHF 324 + ++ +FE P C ++++ + +GK+ + ++ P + Sbjct: 484 LSGKKLFTFEGHEAPVYSICPHQKENIQFIFSTALDGKIKAWLYDNVGSRVDYDAPGQWC 543 Query: 325 SAKVTALDWSRKYGLYSCTK-DSRVYEWNIEDGSVKQTY 438 + + + D SR + + + DS + EWN +G++K+TY Sbjct: 544 TTMLYSADGSRLFSCGTSKEGDSFLVEWNESEGALKRTY 582 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 4/28 (14%) Frame = +1 Query: 367 LYSC--TKD--SRVYEWNIEDGSVKQTY 438 L+SC +KD S + EWN +G+VK+TY Sbjct: 565 LFSCGTSKDGESFIVEWNESEGAVKRTY 592 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 4/28 (14%) Frame = +1 Query: 367 LYSC--TKD--SRVYEWNIEDGSVKQTY 438 L+SC +KD S + EWN +G+VK+TY Sbjct: 565 LFSCGTSKDGESFIVEWNESEGAVKRTY 592 >At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat family protein similar to Sec31p (GI:13928450) {Oryza sativa} Length = 969 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +1 Query: 334 VTALDWSRKYGLY--SCTKDSRVYEWNIEDGSV 426 V A++W LY +C KD+R WN + G + Sbjct: 255 VIAMEWCPSDSLYLLTCGKDNRTICWNTKTGKI 287 >At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 4/28 (14%) Frame = +1 Query: 367 LYSC--TKD--SRVYEWNIEDGSVKQTY 438 L+SC +KD S + EWN +G+VK+TY Sbjct: 565 LFSCGTSKDGESFIVEWNESEGAVKRTY 592 >At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 4/28 (14%) Frame = +1 Query: 367 LYSC--TKD--SRVYEWNIEDGSVKQTY 438 L+SC +KD S + EWN +G+VK+TY Sbjct: 565 LFSCGTSKDGESFIVEWNESEGAVKRTY 592 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,012,918 Number of Sequences: 28952 Number of extensions: 399955 Number of successful extensions: 1126 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1989897600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -