BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0394.Seq (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 25 0.81 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 3.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 4.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 4.3 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 7.6 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 25.0 bits (52), Expect = 0.81 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 509 AVGTGLVSAAANSINQYHEVPLMPQCRGQRTGCLSKV 619 AV T ++ S N YHE ++P+ RG+ C + V Sbjct: 286 AVSTRILRDENLSQNSYHEFQILPE-RGELGHCTASV 321 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.0 bits (47), Expect = 3.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 598 SLSSTLGHQWYFMILIY 548 S S+TL H Y M+L+Y Sbjct: 190 SASTTLSHAEYSMLLVY 206 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/28 (28%), Positives = 11/28 (39%) Frame = -1 Query: 353 YSGVLGDFILYRCSCLSFKWNFTSPVLC 270 Y G+ Y C W T+P +C Sbjct: 476 YDGIRDMIGYYPCCWWKICWTITTPAIC 503 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/28 (28%), Positives = 11/28 (39%) Frame = -1 Query: 353 YSGVLGDFILYRCSCLSFKWNFTSPVLC 270 Y G+ Y C W T+P +C Sbjct: 529 YDGIRDMIGYYPCCWWKICWTITTPAIC 556 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 7.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 678 KALRCLSNAAKPYCMDGL**TLDKHPVL 595 KA R + +A PY + L T KHPV+ Sbjct: 44 KAHRVVLSACSPYFRELLKSTPCKHPVI 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,456 Number of Sequences: 438 Number of extensions: 5176 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -