BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0391.Seq (797 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical pr... 32 0.55 Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical p... 28 8.9 Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical p... 28 8.9 Z73102-13|CAA97405.1| 836|Caenorhabditis elegans Hypothetical p... 28 8.9 AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical ... 28 8.9 >U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical protein T26C11.2 protein. Length = 343 Score = 31.9 bits (69), Expect = 0.55 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 340 EPTPK-ESEPFKSVVPDNKPFGXPFDRPV 257 +PTPK +SEPF +P +KP PF P+ Sbjct: 7 KPTPKPKSEPFPKPMPKSKPKSEPFPSPM 35 >Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical protein ZC434.6b protein. Length = 723 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 211 WSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 83 W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 74 WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical protein ZC434.6a protein. Length = 721 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 211 WSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 83 W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 74 WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >Z73102-13|CAA97405.1| 836|Caenorhabditis elegans Hypothetical protein B0035.12 protein. Length = 836 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/63 (23%), Positives = 25/63 (39%) Frame = +2 Query: 539 LKXARVNLXHEPVKXRRSXXS*XPRPERGXPVSHRNLRXKGHSXTERRLSGQQSGFKNPI 718 L+ + H ++ ++ S P P H R G +++ G GFK P+ Sbjct: 497 LEKVNSQVAHRAIRPQKKV-SEKPAPAPKSKQDHIQKRTSGGEPIVKKVKGDDGGFKAPL 555 Query: 719 XPS 727 PS Sbjct: 556 PPS 558 >AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical protein K06H6.6 protein. Length = 335 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 209 VYHEGELFPYLFNIPHYTPDK 147 VY G L PY + +PH+TP K Sbjct: 302 VYRNGGLNPYDYYLPHWTPLK 322 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,873,920 Number of Sequences: 27780 Number of extensions: 260657 Number of successful extensions: 555 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -