BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0388.Seq (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces pombe... 26 4.8 SPCC553.07c |mug40||DinB translesion DNA repair polymerase|Schiz... 25 8.4 SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 8.4 SPBC2G2.08 |ade9||C-1-tetrahydrofolatesynthase/methylenetetrahyd... 25 8.4 >SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 25.8 bits (54), Expect = 4.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 561 LKPPGYPWRTRP 526 LKPP PW TRP Sbjct: 434 LKPPSSPWPTRP 445 >SPCC553.07c |mug40||DinB translesion DNA repair polymerase|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 151 TFSAPFRLLPIRAMRLFSCARCRAIALR 68 ++ RLL +RA +L S +RC A+ L+ Sbjct: 456 SYPMTIRLLGVRATKLVSKSRCLAMQLK 483 >SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 217 Score = 25.0 bits (52), Expect = 8.4 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -2 Query: 399 SAVHF---PTFNFFTFQHGVSLSRARDDVSHV 313 S VHF P NFF H + LS + +SH+ Sbjct: 145 SHVHFHLIPFINFFLLYHQIILSHSLFHISHL 176 >SPBC2G2.08 |ade9||C-1- tetrahydrofolatesynthase/methylenetetrahydrofolatedehydr ogenase/methylenetetrahydrofolatecyclohydrolase/formylte trahydrofolatesynthetase|Schizosaccharomyces pombe|chr 2|||Manual Length = 969 Score = 25.0 bits (52), Expect = 8.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 586 VASGAVGGSKAPGVPMEDQTLRRWYSVPALT 494 V GA GG A +PM+D L + A+T Sbjct: 441 VKGGAAGGGYAQFIPMDDFNLHMTGDIHAVT 471 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,783,137 Number of Sequences: 5004 Number of extensions: 26784 Number of successful extensions: 52 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -