BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0386.Seq (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_6424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) 29 2.8 SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) 28 4.9 SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) 28 4.9 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 28 6.5 SB_43499| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 55.6 bits (128), Expect = 3e-08 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +1 Query: 4 SVKVHPVVLFQIVDAYERRN--ADSHRVIGTLLGTSDKGVVEVTNCFCVPHKE-HADQVE 174 +V VHP+VL +VD + R RV+G LLG+ KGV++V NCF VP E DQ Sbjct: 10 TVVVHPIVLLSVVDHFNRMGKVGSQKRVVGVLLGSRRKGVLDVANCFAVPFDEDDRDQNV 69 Query: 175 --AELNYAMDVYELNRRVN 225 + +Y ++Y + ++VN Sbjct: 70 WFLDHDYLENMYAMFKKVN 88 >SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVP-HKEHADQVEAEL 183 V+V + + +I+ E + V G LLG +E+TNCF P +K D+ + ++ Sbjct: 18 VQVDGLTVLKIIKHCEEEGSSGDLVQGVLLGLIQDNRLEITNCFPFPSNKAGDDEDDDDV 77 Query: 184 NYAMDVYELNRRVNSSESIVGWW 252 NY M+V R VN VGW+ Sbjct: 78 NYQMEVMRRLRAVNIDHLHVGWY 100 >SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 169 VEAELNYAMDVYELNRRVNSSESIVGWWALAMK*PTTPLLYTSI 300 V EL YA +YEL+++ N +E IVG + + T +++ I Sbjct: 1 VAVELEYAKSMYELSQKANPNEQIVGCVKMGVPGKTEGTMFSQI 44 Score = 31.9 bits (69), Expect = 0.40 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 384 CVPMGVPNGKQRCMFTPVDVTLTWYEPDIVGLQVCQKTVS 503 CV MGVP + MF+ + + P+ VG+ V Q+T S Sbjct: 27 CVKMGVPGKTEGTMFSQIPCEVKLTGPEKVGVDVLQRTKS 66 >SB_6424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 543 GAPRPSPLDPRPHQTQSSGTLVD 475 G RP P+ RP Q Q+ GTLV+ Sbjct: 36 GGKRPGPMARRPGQAQTLGTLVE 58 >SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) Length = 219 Score = 29.1 bits (62), Expect = 2.8 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = -2 Query: 238 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 59 Y+ + CS + PSR +P R R + +R+ W++ +CR P R L ++F Sbjct: 36 YYNYRHVRCSRSREPSR--IPKRFLRRIHNKSRKLRWVVYHRICRKIP-RSSNLHNYINF 92 Query: 58 DVRMRPQFEIK 26 R F+ K Sbjct: 93 GRLRRRYFDSK 103 >SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -2 Query: 238 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 59 Y+ + CS + PSR +P R R + +R+ W++ +CR+ P R L ++F Sbjct: 90 YYNYRHVRCSRSREPSR--IPKRFLRRLHNKSRKLRWVVYHRICRNIP-RSSNLHNYINF 146 Query: 58 D-VRMRP 41 +R RP Sbjct: 147 GRLRRRP 153 >SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) Length = 825 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 Query: 403 GTPIGTQTYARKPIRPPASEVSRVTLTGSR 314 G P+ QT A KP+ PP + + R+ +T +R Sbjct: 84 GLPVAPQTGAGKPVAPPGTTI-RIAVTVNR 112 >SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) Length = 270 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 332 YSGHFAGWRSNGFTCICL 385 ++GH W SNG TC+ L Sbjct: 201 FNGHTYSWHSNGVTCVLL 218 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 6 CEGPSCCFISNCGRIRTSKCRF 71 C G + CFI R R KCRF Sbjct: 78 CRGSNDCFIDKVHRNRCQKCRF 99 >SB_43499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 457 YHVRVTSTGVNMQRCFPLGTPIGTQTYARK 368 YH+R T++ V + C PLG IG ++K Sbjct: 53 YHLRRTASTVLVHSCLPLGYYIGLGMISKK 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,010,159 Number of Sequences: 59808 Number of extensions: 487250 Number of successful extensions: 1602 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1600 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -