BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0382.Seq (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4C3.07 |||translation initiation factor eIF3f|Schizosaccharo... 81 9e-17 SPCC1682.10 |rpn8||19S proteasome regulatory subunit Rpn8|Schizo... 57 2e-09 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 27 2.7 SPBC1685.05 |||serine protease |Schizosaccharomyces pombe|chr 2|... 26 3.6 SPAC24H6.05 |cdc25|sal2|serine/threonine protein phosphatase Cdc... 26 4.8 SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr... 25 6.3 >SPBC4C3.07 |||translation initiation factor eIF3f|Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 81.4 bits (192), Expect = 9e-17 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 2/87 (2%) Frame = +1 Query: 1 ISVKVHPVVLFQIVDAYERRNADSHRVIGTLLGT--SDKGVVEVTNCFCVPHKEHADQVE 174 +++ + P VLF I+D R++ ++ RVIGTLLGT D +E+ +CF VPH E ++QVE Sbjct: 21 LNIVIEPAVLFSILDHSTRKSENNQRVIGTLLGTRSEDGREIEIKSCFAVPHNESSEQVE 80 Query: 175 AELNYAMDVYELNRRVNSSXSIVGWWA 255 E+ Y +Y L+ + N +VGW+A Sbjct: 81 VEMEYHRAMYHLHLKANPREVVVGWYA 107 >SPCC1682.10 |rpn8||19S proteasome regulatory subunit Rpn8|Schizosaccharomyces pombe|chr 3|||Manual Length = 324 Score = 56.8 bits (131), Expect = 2e-09 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 4/86 (4%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERR-NADSHRVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVEA-- 177 V VHP+VL VD+Y R RV+G LLG ++ VV V N + +P +E Sbjct: 17 VIVHPLVLLSAVDSYNRSAKGTKRRVVGILLGQNNGDVVNVANSYAIPFEEDEKNASVWF 76 Query: 178 -ELNYAMDVYELNRRVNSSXSIVGWW 252 + N+ + E+ +++N++ +VGW+ Sbjct: 77 LDHNFMESMNEMFKKINANEKLVGWY 102 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 26.6 bits (56), Expect = 2.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 49 YERRNADSHRVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVE 174 Y+ R DSHR I L GT + + + + +K H ++E Sbjct: 483 YDHRLRDSHREIYQLQGTGYRPFLRANDNASINNKNHHKELE 524 >SPBC1685.05 |||serine protease |Schizosaccharomyces pombe|chr 2|||Manual Length = 997 Score = 26.2 bits (55), Expect = 3.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 553 LRQVRARGHAARPATPPDTVFWXTC 479 ++Q+ RG + + PD +FW TC Sbjct: 949 VKQMNRRGATSIVSVRPDPLFWPTC 973 >SPAC24H6.05 |cdc25|sal2|serine/threonine protein phosphatase Cdc25|Schizosaccharomyces pombe|chr 1|||Manual Length = 596 Score = 25.8 bits (54), Expect = 4.8 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 60 KCRFSQSYRHLIGHERQRSGG-SNQLLLRATQRTCRSSRSGT*LRDGCL 203 + R S SY I ++ SGG + + L A RTC S + T L + CL Sbjct: 201 RSRSSSSYS--INKKKGTSGGQATRHLTYALSRTCSQSSNTTSLLESCL 247 >SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 131 Score = 25.4 bits (53), Expect = 6.3 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = +2 Query: 422 HVHSCRCHSHM 454 H+H CRCH+++ Sbjct: 69 HIHCCRCHTYI 79 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,533,588 Number of Sequences: 5004 Number of extensions: 53182 Number of successful extensions: 159 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -