BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0381.Seq (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 31 0.64 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 31 0.64 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 31.5 bits (68), Expect = 0.64 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 37 VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 171 +W ++ L L VF +A PF ++ P H+IED +E EK Sbjct: 1148 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1192 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 31.5 bits (68), Expect = 0.64 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 37 VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 171 +W ++ L L VF +A PF ++ P H+IED +E EK Sbjct: 1147 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1191 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,357,190 Number of Sequences: 28952 Number of extensions: 325677 Number of successful extensions: 716 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -