BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0378.Seq (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45627| Best HMM Match : AAA (HMM E-Value=0) 101 8e-22 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 101 bits (241), Expect = 8e-22 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = +2 Query: 80 DDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETV 256 D+L+TAIL+ K RPNRL+VEEAV+DDNSVV +SQAKME+LQLFRGDTVL+KGK+RK+TV Sbjct: 5 DELATAILKNKSRPNRLLVEEAVNDDNSVVTMSQAKMEELQLFRGDTVLIKGKKRKDTV 63 Score = 42.3 bits (95), Expect = 4e-04 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +3 Query: 510 VRGGMRAVEFKVVETD--PFTILHRGLLITVIHCER*TD*T*GRRGSTKMXSGYDDIG 677 VRGGMRAVEFKV+ETD P+ I+ TVIHCE + GYDDIG Sbjct: 108 VRGGMRAVEFKVIETDPSPYCIVAPD---TVIHCEG-EPVKREEEEESLNEVGYDDIG 161 Score = 31.9 bits (69), Expect = 0.58 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVV 351 L +G+ + CIVLSDD D+KIRM DVV Sbjct: 53 LIKGKKRKDTVCIVLSDDTISDDKIRMNRVVRMNLRVRLGDVV 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,361,563 Number of Sequences: 59808 Number of extensions: 541481 Number of successful extensions: 1326 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1325 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -