BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0377.Seq (759 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U34596-1|AAA97605.1| 570|Caenorhabditis elegans SMA-4 protein. 36 0.031 U00066-5|AAA50739.2| 565|Caenorhabditis elegans Small protein 4... 36 0.031 U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical pr... 31 0.67 AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a... 29 4.7 Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical p... 28 8.3 Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical p... 28 8.3 AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical ... 28 8.3 >U34596-1|AAA97605.1| 570|Caenorhabditis elegans SMA-4 protein. Length = 570 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -3 Query: 676 LTPSVKNVPLDLNTMRTAFPSALEDNWMN--FYELD 575 +TP + ++P+DLN + P L DNW + +YELD Sbjct: 324 VTPIISDIPIDLNQIYVPTPPQLLDNWCSIIYYELD 359 >U00066-5|AAA50739.2| 565|Caenorhabditis elegans Small protein 4, isoform a protein. Length = 565 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -3 Query: 676 LTPSVKNVPLDLNTMRTAFPSALEDNWMN--FYELD 575 +TP + ++P+DLN + P L DNW + +YELD Sbjct: 319 VTPIISDIPIDLNQIYVPTPPQLLDNWCSIIYYELD 354 >U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical protein T26C11.2 protein. Length = 343 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 340 EPTPK-ESEPFKSVVPDNKPFGYPFDRPV 257 +PTPK +SEPF +P +KP PF P+ Sbjct: 7 KPTPKPKSEPFPKPMPKSKPKSEPFPSPM 35 >AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily assigned gene nameprotein 192 protein. Length = 2957 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 531 RSSTDFAFSKKTLYRWPKSTSSWTKERFLLTCS 433 R + F++K L WP T W + R LLT S Sbjct: 2020 RVDENLCFAEKNLAVWPGQTDFWLRFRRLLTSS 2052 >Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical protein ZC434.6b protein. Length = 723 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 211 WSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 83 W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 74 WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical protein ZC434.6a protein. Length = 721 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 211 WSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 83 W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 74 WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical protein K06H6.6 protein. Length = 335 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 209 VYHEGELFPYLFNIPHYTPDK 147 VY G L PY + +PH+TP K Sbjct: 302 VYRNGGLNPYDYYLPHWTPLK 322 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,145,894 Number of Sequences: 27780 Number of extensions: 308137 Number of successful extensions: 778 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -