BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0377.Seq (759 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 48 7e-08 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 48 7e-08 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 47 2e-07 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 47 2e-07 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 41 1e-05 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 41 1e-05 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 37 2e-04 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 33 0.002 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 26 0.44 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 26 0.44 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 26 0.44 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 1.3 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 22 5.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.4 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 9.5 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 9.5 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 9.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 9.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 9.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 9.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 9.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 9.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.5 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 9.5 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 48.4 bits (110), Expect = 7e-08 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 6/92 (6%) Frame = -3 Query: 514 CIFKEDSLPMAEIYKLLDQGKIPTDM-FNSSDTM---PSRLMLPKGTYDGFPFQLFVFVY 347 C F + L +EI+ + + +D F ++ + P RL+LP+G +G PFQLF++V Sbjct: 564 CFFTMNDLEPSEIFYEKIETSLNSDKPFTYNERIFGFPGRLLLPRGKKEGMPFQLFLYVS 623 Query: 346 PY--EPTPKESEPFKSVVPDNKPFGYPFDRPV 257 P E S + D + FG+P D+P+ Sbjct: 624 PVSSEYNQYNSRIWGGYKFDKRSFGFPLDKPL 655 Score = 28.3 bits (60), Expect = 0.083 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 245 FKQPNMFFKKVLVYHEGE 192 ++ PNM FK +L+YH+ E Sbjct: 660 YEGPNMLFKDILIYHKDE 677 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 48.4 bits (110), Expect = 7e-08 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 6/92 (6%) Frame = -3 Query: 514 CIFKEDSLPMAEIYKLLDQGKIPTDM-FNSSDTM---PSRLMLPKGTYDGFPFQLFVFVY 347 C F + L +EI+ + + +D F ++ + P RL+LP+G +G PFQLF++V Sbjct: 564 CFFTMNDLEPSEIFYEKIETSLNSDKPFTYNERIFGFPGRLLLPRGKKEGMPFQLFLYVS 623 Query: 346 PY--EPTPKESEPFKSVVPDNKPFGYPFDRPV 257 P E S + D + FG+P D+P+ Sbjct: 624 PVSSEYNQYNSRIWGGYKFDKRSFGFPLDKPL 655 Score = 28.3 bits (60), Expect = 0.083 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 245 FKQPNMFFKKVLVYHEGE 192 ++ PNM FK +L+YH+ E Sbjct: 660 YEGPNMLFKDILIYHKDE 677 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 47.2 bits (107), Expect = 2e-07 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 6/124 (4%) Frame = -3 Query: 610 LEDNWMNFYELDWFVPKG*PWPVSDNAFIY*LCIFKEDSLPMAEIYKLLDQGKIPTDMFN 431 L N+MNF ++D FV + + D +P +Y L + ++ F Sbjct: 531 LVHNYMNFMQMDEFVVNLKSGSNTIERNSHESVFVVPDEVPSDVLYNRLVVSEDGSETFK 590 Query: 430 SSDT---MPSRLMLPKGTYDGFPFQLFVFVYPYEPT---PKESEPFKSVVPDNKPFGYPF 269 S P RL+LPKG +G P+ + V V P++ + +S + + D + G+P Sbjct: 591 YSSQPYGFPERLLLPKGKKEGMPYNVLVVVSPFDDSNVVQIDSPVWGRHIYDGRAMGFPL 650 Query: 268 DRPV 257 D+PV Sbjct: 651 DKPV 654 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 650 LGPKYDENG 624 LGPKYDE G Sbjct: 518 LGPKYDEFG 526 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 47.2 bits (107), Expect = 2e-07 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 6/124 (4%) Frame = -3 Query: 610 LEDNWMNFYELDWFVPKG*PWPVSDNAFIY*LCIFKEDSLPMAEIYKLLDQGKIPTDMFN 431 L N+MNF ++D FV + + D +P +Y L + ++ F Sbjct: 531 LVHNYMNFMQMDEFVVNLKSGSNTIERNSHESVFVVPDEVPSDVLYNRLVVSEDGSETFK 590 Query: 430 SSDT---MPSRLMLPKGTYDGFPFQLFVFVYPYEPT---PKESEPFKSVVPDNKPFGYPF 269 S P RL+LPKG +G P+ + V V P++ + +S + + D + G+P Sbjct: 591 YSSQPYGFPERLLLPKGKKEGMPYNVLVVVSPFDDSNVVQIDSPVWGRHIYDGRAMGFPL 650 Query: 268 DRPV 257 D+PV Sbjct: 651 DKPV 654 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 650 LGPKYDENG 624 LGPKYDE G Sbjct: 518 LGPKYDEFG 526 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 41.1 bits (92), Expect = 1e-05 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 6/85 (7%) Frame = -3 Query: 493 LPMAEIYKLLDQGKIPTDMFNSSDTM---PSRLMLPKGTYDGFPFQLFVFVYPYEPTPKE 323 +P Y L++ ++ F S+ M P RL+LP+G +G +++F F+ + + + Sbjct: 574 MPSDIFYDKLNKAIGGSEPFTYSEKMLGFPERLILPRGKPEGMRYKMFFFLSSMDESNTK 633 Query: 322 SEP---FKSVVPDNKPFGYPFDRPV 257 S + + D+K FG+P DRP+ Sbjct: 634 SYEIPLYGKMTLDDKVFGFPLDRPM 658 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 245 FKQPNMFFKKVLVYH 201 F PNM+FK V +Y+ Sbjct: 663 FTIPNMYFKDVFIYN 677 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 41.1 bits (92), Expect = 1e-05 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 6/85 (7%) Frame = -3 Query: 493 LPMAEIYKLLDQGKIPTDMFNSSDTM---PSRLMLPKGTYDGFPFQLFVFVYPYEPTPKE 323 +P Y L++ ++ F S+ M P RL+LP+G +G +++F F+ + + + Sbjct: 574 MPSDIFYDKLNKAIGGSEPFTYSEKMLGFPERLILPRGKPEGMRYKMFFFLSSMDESNTK 633 Query: 322 SEP---FKSVVPDNKPFGYPFDRPV 257 S + + D+K FG+P DRP+ Sbjct: 634 SYEIPLYGKMTLDDKVFGFPLDRPM 658 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 245 FKQPNMFFKKVLVYH 201 F PNM+FK V +Y+ Sbjct: 663 FTIPNMYFKDVFIYN 677 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 36.7 bits (81), Expect = 2e-04 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 18/96 (18%) Frame = -3 Query: 496 SLPMAEIYKLLDQGK-IPTDMFNSSDTM----PSRLMLPKGTYDGFPFQLFVFVYPY-EP 335 ++P ++ LD+ + I D D P +++PKG +GF +LFV V Y + Sbjct: 552 TIPFERTFRNLDENRPIGGDSLERFDFCGCGWPQHMLIPKGNKEGFAMELFVMVSDYKDD 611 Query: 334 TPKESEPF------------KSVVPDNKPFGYPFDR 263 +++EP PD + GYPFDR Sbjct: 612 RVEQNEPIGCKDASSYCGLRDRKYPDARAMGYPFDR 647 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 650 LGPKYDENGFPFS 612 +GPK DE G PF+ Sbjct: 505 IGPKEDERGLPFT 517 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 33.5 bits (73), Expect = 0.002 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 421 TMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPD 293 + P+RL LPKG GFP Q V + P + P+ V+P+ Sbjct: 620 SFPARLSLPKGQPQGFPLQFLVVISSSNPL---NVPYGPVIPE 659 Score = 26.6 bits (56), Expect = 0.25 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -2 Query: 236 PNMFFKKVLVYHEGE 192 PN+F K VLV+H+G+ Sbjct: 989 PNIFVKDVLVFHQGQ 1003 Score = 25.4 bits (53), Expect = 0.58 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 295 DNKPFGYPFDRPV 257 D KP G+P DRP+ Sbjct: 969 DGKPLGFPLDRPL 981 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 650 LGPKYDENGFPFS 612 LGPK+D G P S Sbjct: 539 LGPKHDHQGRPIS 551 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.8 bits (54), Expect = 0.44 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +3 Query: 369 KGNPSYVPLGSISLEGIVSEEL 434 KG+ ++VPL ++S EG+ S++L Sbjct: 587 KGDVAFVPLTALSEEGVQSKDL 608 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.8 bits (54), Expect = 0.44 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +3 Query: 369 KGNPSYVPLGSISLEGIVSEEL 434 KG+ ++VPL ++S EG+ S++L Sbjct: 587 KGDVAFVPLTALSEEGVQSKDL 608 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.8 bits (54), Expect = 0.44 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +3 Query: 369 KGNPSYVPLGSISLEGIVSEEL 434 KG+ ++VPL ++S EG+ S++L Sbjct: 587 KGDVAFVPLTALSEEGVQSKDL 608 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 564 QKVNPGQXQITRSSTDFAFSKKTLY 490 + + GQ + R+ST+F TLY Sbjct: 530 EAIRSGQTSVQRASTEFGIPTGTLY 554 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 386 CTLRQHQPRR 415 CTLR+H+P R Sbjct: 1 CTLRKHKPNR 10 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -3 Query: 211 WSTMKENYSPIYLTFLTIHQI 149 ++ NY P+Y + I QI Sbjct: 324 YNNYNNNYKPLYYNIINIEQI 344 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 156 FIPPNAYRFRPSL 168 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 156 FIPPNAYRFRPSL 168 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 156 FIPPNAYRFRPSL 168 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 387 FIPPNAYRFRPSL 399 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 387 FIPPNAYRFRPSL 399 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 387 FIPPNAYRFRPSL 399 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 387 FIPPNAYRFRPSL 399 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 376 FIPPNAYRFRPSL 388 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 454 FLGPRACRFRPSV 492 F+ P A RFRPS+ Sbjct: 389 FIPPNAYRFRPSL 401 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 650 LGPKYDENG 624 LGPKYDE G Sbjct: 144 LGPKYDEFG 152 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,871 Number of Sequences: 438 Number of extensions: 3964 Number of successful extensions: 44 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -