BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0376.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 3.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.5 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +2 Query: 290 RSSRRLYLISQERFVKCSKRDAQKQALTRATRYSRYTTPKERTGRHYRTD 439 R R Y R+ K + +K+ L T RY+ +ER + Y+ + Sbjct: 239 RDRNREYKKKDRRYEKL--HNEKKKLLEERTSRKRYSRSREREQKSYKNE 286 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -2 Query: 466 WWWNSKPSRI 437 WWWN K S + Sbjct: 366 WWWNMKISNL 375 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 287 EAVLTPLLGDCSPG 246 +A+ T L DC PG Sbjct: 642 DAICTKLTADCQPG 655 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +2 Query: 341 SKRDAQKQALTRATRYSRYTTPKERTGRHYRTDTRR 448 S R + ++ +SRY + G YR D R Sbjct: 216 SLRSRSRSFQRTSSCHSRYEDSRHEDGNSYRNDGER 251 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/38 (28%), Positives = 15/38 (39%) Frame = +1 Query: 346 ERRTKAGIDKSYPLQPIHNTERTNRKTLPNGYAKVSNS 459 ER + I S + IHN N N Y +N+ Sbjct: 307 ERSREPKIISSLSNKTIHNNNNYNNNNYNNNYNNYNNN 344 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,633 Number of Sequences: 438 Number of extensions: 3694 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -