Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesV0374.Seq
         (738 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    23   2.3  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   6.9  

>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = +2

Query: 209 NTIYTIGNKEP---CSQYDSKALSSAITKFSAKFCNELDKKKN 328
           NT+Y + +       S+YD+K  +  IT F   F     KKK+
Sbjct: 358 NTMYVLSDNFQQLLFSKYDAKKRNFFITMFDLDFLTNACKKKD 400


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 697  CLHSRDL*CV 668
            CLH RDL CV
Sbjct: 1098 CLHHRDLPCV 1107


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 189,038
Number of Sequences: 438
Number of extensions: 3872
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23023035
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)