BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0373.Seq (790 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 4.7 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 24 6.2 DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 23 8.1 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 622 TGGRSRPGPQ*NPNGGLKN*TPELKPP 702 TGG P P P G + N P+ PP Sbjct: 524 TGGPLGPPPPPPPGGAVLNIPPQFLPP 550 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.8 bits (49), Expect = 6.2 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +2 Query: 173 LIIIDDICQSFVNTIYTIGNKEPCSQYDSKALSSAITKFSAKFCN 307 L I+D+I S+V +I +++PC +D + ++ + F N Sbjct: 28 LSIVDEIVLSYVISILEEASQDPC--FDVEGFIEMMSAYFNDFAN 70 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 363 LALITLGTTDPAHEELLTSLGIPDDDTIRSSF 458 L LIT G + +ELL +L + + IR+ + Sbjct: 91 LTLITEGASGRTLDELLVALDVQQQEQIRNYY 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 814,389 Number of Sequences: 2352 Number of extensions: 17060 Number of successful extensions: 37 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -