BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0371.Seq (786 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 24 1.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 24 1.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.1 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 4.8 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 6.4 DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 21 8.4 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 8.4 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 598 YWKGAGQPILREMENV 645 YW GA P RE ENV Sbjct: 221 YWGGADTPWQREYENV 236 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 24.2 bits (50), Expect = 1.2 Identities = 18/65 (27%), Positives = 23/65 (35%) Frame = -2 Query: 335 RPVRCPKLGR*F*RKPVVVHEDSSQAPEAPRCPXXXXXXXXXXXXXRVIISQRGESGPIF 156 +P C K F R+ +VH EA R P R G GP+ Sbjct: 245 KPFECDKCRGRFRRRHHLVHHKCGGEEEAERAPAPAVRAAGDAAAARGAARADGAGGPL- 303 Query: 155 ENHRP 141 +HRP Sbjct: 304 HDHRP 308 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 354 SASHHSKSISRTNKKCVSFILLFMTFSDINVSWTRP 461 S S ++ SIS KK ++++ M+ + VS RP Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 354 SASHHSKSISRTNKKCVSFILLFMTFSDINVSWTRP 461 S S ++ SIS KK ++++ M+ + VS RP Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/27 (25%), Positives = 19/27 (70%) Frame = -3 Query: 436 SENVINNRINETHFLFVLEIDLLWWLA 356 +EN I++++ + + F++ + L+W +A Sbjct: 427 NENTIHSKLCKLYATFLIALKLVWIVA 453 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 372 KSISRTNKKCVSFILLF 422 K++ +TNK C +FI+LF Sbjct: 313 KTVLKTNKYC-NFIILF 328 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 508 RHIVWAIPDGVSETSLGGQTKGRARTRYNNYWKGAG 615 RH++ P E KG ++RYN++ + G Sbjct: 87 RHLIKNKPSWWQELQEKYDPKGEYKSRYNHFLEEEG 122 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 359 CREDEPLLRPVRCPKLG 309 C++D P++R KLG Sbjct: 176 CQDDTPMVRRAAATKLG 192 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,983 Number of Sequences: 336 Number of extensions: 4132 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -