BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0369.Seq (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 26 1.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 25 2.6 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 3.4 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 25 3.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 5.9 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 23 7.8 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 7.8 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 22 KCQKSRNNGRRRNPREIGGW 81 K SR N RRR+PR G W Sbjct: 249 KIPPSRRNPRRRSPRSGGRW 268 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 25.0 bits (52), Expect = 2.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 720 RNNLPAFNLRCRLGG 764 RNNLP + RCRL G Sbjct: 938 RNNLPPYAARCRLLG 952 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 3.4 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +1 Query: 262 YSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRV 414 Y+ A L+DP I ++ K P + + +DP GEF + V Sbjct: 2692 YNYRARLYDPDIGRFYQMDPKEQYPSPYVYAGNSPVSLIDPDGEFAFTLAV 2742 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 443 GYPSSERPQRTRVETTNSPAGSR 375 G S + PQR+ + T+SP GS+ Sbjct: 300 GSDSEDLPQRSAEDRTHSPVGSQ 322 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 629 PAGKRSPSLNRKWSSMSC 576 P G ++P LNRK SC Sbjct: 1149 PGGSKTPILNRKEKPKSC 1166 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.4 bits (48), Expect = 7.8 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = -3 Query: 629 PAGKRSPSLNRKWSSMSCCWVSFEHAGEGVERALELALEADRVPETLSSISLYWDSV 459 P G P W S + W F +A E V + L + +R+ + +S+ +D V Sbjct: 92 PKGVDMPRTTFTWCSKAFLWAYFIYACETV---IVLVVARERINKFISTSDKRFDEV 145 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 7.8 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +2 Query: 92 LQGSDSKSLLKKYX--TREVFDSLKNKKTSFGSTL-LDCIQSGVENLDSGVGIYAPDASR 262 L+ +S KY + E D L+N + GST +C+ +G L + P R Sbjct: 744 LRSVESAERAAKYDIFSNECSDLLENCEA--GSTASAECVTNGDYMLQPSNAPFTPPTDR 801 Query: 263 TPCSP 277 TP P Sbjct: 802 TPTPP 806 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,709 Number of Sequences: 2352 Number of extensions: 13245 Number of successful extensions: 45 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -