BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0359.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 5.3 AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding pr... 23 7.0 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 23 7.0 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 301 QQEARVTKHPLQHHHLRALNPMLVW*SSRH 390 QQ + +H LQHHH L+ SS H Sbjct: 1320 QQHQQHQQHQLQHHHQPQLSQSSHHSSSSH 1349 >AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding protein AgamOBP47 protein. Length = 178 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 154 LLALYTLRSAKAR*P--NNVALDAIDGGLRLA 65 L LY L S K+ P N + LDAIDG ++A Sbjct: 82 LTKLY-LASTKSMAPEWNKITLDAIDGCFKMA 112 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 154 LLALYTLRSAKAR*P--NNVALDAIDGGLRLA 65 L LY L S K+ P N + LDAIDG ++A Sbjct: 132 LTKLY-LASTKSMAPEWNKITLDAIDGCFKMA 162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,889 Number of Sequences: 2352 Number of extensions: 9947 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -