BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0358.Seq (747 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 4.0 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 7.0 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 9.3 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 467 RCLPRSHVYEGGGRTNDEHSE 405 +C+ H+ GG ND H+E Sbjct: 300 KCVSGEHLSVSGGALNDCHAE 320 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 461 LPRSHVYEGGGRTNDEHSEQELVVL 387 LPR + E + DE E+E+VV+ Sbjct: 345 LPRFLLIERPKKDEDEEEEEEVVVV 369 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = -3 Query: 511 MRLANPRHGRYLTVAAVFRGRMSMKEVDEQMMNIQNKNSSYF 386 MRL++P HG L + + K + ++ ++K +F Sbjct: 355 MRLSHPLHGNLLPPGVCYTCDVCGKTLSTKLTLKRHKEQQHF 396 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,814 Number of Sequences: 438 Number of extensions: 3376 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -