BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0357.Seq (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 26 1.5 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 25 1.9 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 7.9 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 25.8 bits (54), Expect = 1.5 Identities = 24/77 (31%), Positives = 30/77 (38%), Gaps = 1/77 (1%) Frame = -3 Query: 460 GACGTPACADSDVVNWERFGIRPRYEWNSFT-LASSGDNAAIPTNPKTTIFPSVKNSGAF 284 G PA AD + +S T LA+ NA KT IF V +GA Sbjct: 2 GQPAKPAAADQQANRLHAPTANTKKVSDSVTNLAAKIANALSNQKSKTEIFSPVSIAGAL 61 Query: 283 NFNLIGLGSIFLMTLLA 233 + L+G G LLA Sbjct: 62 SLLLLGSGGQTQQELLA 78 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.4 bits (53), Expect = 1.9 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +2 Query: 389 SWSDPEPFPVYYVGVCTGW-GATGSWKIEVPPTAPVAAALYQPPLATLEATEETYP 553 +WSD P P T W T + VPPT + L PP T T T P Sbjct: 206 TWSDLPPPPP--TTTTTVWIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTTVWTDP 259 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 7.9 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = +3 Query: 51 TIMANVMDVATDDNLQYQFFPVSSGSVQFKVRAANDAHIALTTGPQESDPMYEVMIGGW 227 T A V TD+N+QY + + F V +ND I+ +++ P W Sbjct: 473 TFSARVGRGLTDENMQYMYRKAYRDKLSFSV--SNDQMISFAQFCKDTTPECNYTFWEW 529 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,770 Number of Sequences: 2352 Number of extensions: 18439 Number of successful extensions: 142 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -