BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0355.Seq (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 24 1.5 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 4.6 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -1 Query: 386 KC**FPSDEAHQVLHFWMIHQQNGRYSMSSE*LAHQVIEQLKRLH 252 KC ++ H+V MIH+ N + + ++ H I +L+ LH Sbjct: 72 KCEQKQKEDVHKVFQHLMIHRPNWWHELETKFNPHHEI-KLQHLH 115 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 108 TLLFQCLVRSTLCTKFVSEEHRLSSVAFEWL 200 TLL ++ + C SE +++ + F WL Sbjct: 292 TLLLFTILLAYGCAGATSEAEKIAKICFYWL 322 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,115 Number of Sequences: 336 Number of extensions: 3837 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -