BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0352.Seq (728 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q17PF2 Cluster: Putative uncharacterized protein; n=2; ... 38 0.25 UniRef50_Q9SEW4 Cluster: Vicilin-like protein; n=3; Juglandaceae... 35 2.3 UniRef50_Q9VIX6 Cluster: GH19142p; n=2; Drosophila melanogaster|... 35 2.3 UniRef50_A6Q9L6 Cluster: Putative uncharacterized protein; n=1; ... 34 4.1 UniRef50_Q29K42 Cluster: GA14551-PA; n=3; Drosophila|Rep: GA1455... 33 5.4 UniRef50_A5K876 Cluster: WD domain, G-beta repeat domain contain... 33 7.2 >UniRef50_Q17PF2 Cluster: Putative uncharacterized protein; n=2; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 241 Score = 37.9 bits (84), Expect = 0.25 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -3 Query: 567 GAQPNDGNQFVQCLVFFVLLSVNDNGEVKNHRAAETVVNNNGKVTKYKVEN 415 G+Q G FV F S N NG+ +HR A T VN+NGKVT Y V N Sbjct: 195 GSQQGGGPGFVGVSSFSS--SSNINGQ--SHREASTTVNDNGKVTTYHVRN 241 >UniRef50_Q9SEW4 Cluster: Vicilin-like protein; n=3; Juglandaceae|Rep: Vicilin-like protein - Juglans regia (English walnut) Length = 593 Score = 34.7 bits (76), Expect = 2.3 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 505 CERQRRGQESQSCRNSCQ*QRKSHQ 431 CERQRRGQE CR C+ +R+ + Sbjct: 83 CERQRRGQEQTLCRRRCEQRRQQEE 107 >UniRef50_Q9VIX6 Cluster: GH19142p; n=2; Drosophila melanogaster|Rep: GH19142p - Drosophila melanogaster (Fruit fly) Length = 287 Score = 34.7 bits (76), Expect = 2.3 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 501 NDNGEVKNHRAAETVVNNNGKVTKYKVEN 415 + NG+ + R A+T VN+NGK+T Y V + Sbjct: 259 HSNGDGTSRRGAQTTVNDNGKITSYSVHS 287 >UniRef50_A6Q9L6 Cluster: Putative uncharacterized protein; n=1; Sulfurovum sp. NBC37-1|Rep: Putative uncharacterized protein - Sulfurovum sp. (strain NBC37-1) Length = 153 Score = 33.9 bits (74), Expect = 4.1 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 Query: 406 ISLVFDFILGDFSVVIDNCFCSSVILDLSVVV 501 I L +DFI S+V+DN S+I+DL VVV Sbjct: 120 ILLAYDFIFSTHSIVLDNILLYSLIVDLLVVV 151 >UniRef50_Q29K42 Cluster: GA14551-PA; n=3; Drosophila|Rep: GA14551-PA - Drosophila pseudoobscura (Fruit fly) Length = 241 Score = 33.5 bits (73), Expect = 5.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 501 NDNGEVKNHRAAETVVNNNGKVTKYKVEN 415 + NG+ + R A+T VN+NGKVT Y + Sbjct: 213 HSNGDGTSRRGAQTTVNDNGKVTSYSTHS 241 >UniRef50_A5K876 Cluster: WD domain, G-beta repeat domain containing protein; n=4; Plasmodium|Rep: WD domain, G-beta repeat domain containing protein - Plasmodium vivax Length = 644 Score = 33.1 bits (72), Expect = 7.2 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -1 Query: 491 ERSRITELQKQLSITTEKSPSIKSKTKLIRSQIKLNFYTQFS 366 E +I EL++QL K SI +K +RS IK FYT+ S Sbjct: 140 EYLKINELEEQLGTKRLKQQSIAAKGITVRSTIKEKFYTESS 181 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,602,464 Number of Sequences: 1657284 Number of extensions: 10493279 Number of successful extensions: 25640 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 24505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25633 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 58853922985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -