BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0348.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 26 0.30 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 26.2 bits (55), Expect = 0.30 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 514 LFTHLDESERADMFDAMFPVQCLPGETVIRQGDEGDKLFILIDSRRG*GFSVKRAET 684 +F +L E + D + G+ +IRQG GD FI+ SR ++K+ +T Sbjct: 220 IFKNLPEETLIKISDVLEETFYNNGDYIIRQGARGDTFFII--SRGQVRVTIKQPDT 274 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 586 GETVIRQGDEGDKLFILIDSR 648 G T+IR+GD G ++++ + + Sbjct: 126 GSTIIREGDVGSIVYVMEEGK 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,535 Number of Sequences: 438 Number of extensions: 3636 Number of successful extensions: 7 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -